DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED9 and MED9

DIOPT Version :9

Sequence 1:NP_788400.1 Gene:MED9 / 37079 FlyBaseID:FBgn0260401 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_060489.1 Gene:MED9 / 55090 HGNCID:25487 Length:146 Species:Homo sapiens


Alignment Length:88 Identity:30/88 - (34%)
Similarity:55/88 - (62%) Gaps:10/88 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DQLDIEILPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFESAREQIRQLPGIDFNKEE 117
            ::.:...||::::|::|::||..|      ..||.|    .|:.:|:..|:.|..:|||..:.|:
Human    59 EEENYSFLPLVHNIIKCMDKDSPE------VHQDLN----ALKSKFQEMRKLISTMPGIHLSPEQ 113

  Fly   118 QQQRLELLRNQLKLKQQLIRKYK 140
            |||:|:.||.|::.|.:|::|||
Human   114 QQQQLQSLREQVRTKNELLQKYK 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED9NP_788400.1 Med9 58..142 CDD:400090 30/83 (36%)
MED9NP_060489.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 0/2 (0%)
Med9 64..139 CDD:400090 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148017
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D40N
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008377
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109853
Panther 1 1.100 - - LDO PTHR20844
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4652
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.