DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED9 and MED9

DIOPT Version :10

Sequence 1:NP_788400.1 Gene:MED9 / 37079 FlyBaseID:FBgn0260401 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_060489.1 Gene:MED9 / 55090 HGNCID:25487 Length:146 Species:Homo sapiens


Alignment Length:88 Identity:30/88 - (34%)
Similarity:55/88 - (62%) Gaps:10/88 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DQLDIEILPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFESAREQIRQLPGIDFNKEE 117
            ::.:...||::::|::|::||..|      ..||.|    .|:.:|:..|:.|..:|||..:.|:
Human    59 EEENYSFLPLVHNIIKCMDKDSPE------VHQDLN----ALKSKFQEMRKLISTMPGIHLSPEQ 113

  Fly   118 QQQRLELLRNQLKLKQQLIRKYK 140
            |||:|:.||.|::.|.:|::|||
Human   114 QQQQLQSLREQVRTKNELLQKYK 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED9NP_788400.1 Med9 58..142 CDD:462202 30/83 (36%)
MED9NP_060489.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 0/2 (0%)
Med9-C 54..137 CDD:467847 25/77 (32%)

Return to query results.
Submit another query.