powered by:
Protein Alignment MED9 and Med9
DIOPT Version :9
| Sequence 1: | NP_788400.1 |
Gene: | MED9 / 37079 |
FlyBaseID: | FBgn0260401 |
Length: | 144 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_038942495.1 |
Gene: | Med9 / 497914 |
RGDID: | 1563669 |
Length: | 143 |
Species: | Rattus norvegicus |
| Alignment Length: | 35 |
Identity: | 10/35 - (28%) |
| Similarity: | 16/35 - (45%) |
Gaps: | 11/35 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 115 KEEQQQRLELLRNQLK-----------LKQQLIRK 138
|||....|.|:.|.:| :|:.::||
Rat 55 KEENYSFLPLVHNVIKWMGLAALACGLVKEAVVRK 89
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| MED9 | NP_788400.1 |
Med9 |
58..142 |
CDD:400090 |
10/35 (29%) |
| Med9 | XP_038942495.1 |
None |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C166341891 |
| Domainoid |
1 |
1.000 |
59 |
1.000 |
Domainoid score |
I10441 |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
1 |
1.000 |
- |
- |
|
|
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
1 |
1.050 |
60 |
1.000 |
Inparanoid score |
I5312 |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0008377 |
| OrthoInspector |
1 |
1.000 |
- |
- |
|
oto96120 |
| orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_109853 |
| Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR20844 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.890 |
|
Return to query results.
Submit another query.
