DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED9 and Med9

DIOPT Version :9

Sequence 1:NP_788400.1 Gene:MED9 / 37079 FlyBaseID:FBgn0260401 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_619616.2 Gene:Med9 / 192191 MGIID:2183151 Length:142 Species:Mus musculus


Alignment Length:81 Identity:27/81 - (33%)
Similarity:51/81 - (62%) Gaps:10/81 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFESAREQIRQLPGIDFNKEEQQQRLEL 124
            ||:::::::|::||          |.|.:..:..|:.:|:..|:.|..:|||..:.|:|||:|..
Mouse    62 LPLVHNVIKCMDKD----------SPDLHQDLNALKTKFQELRKLIGTMPGIHVSPEQQQQQLHS 116

  Fly   125 LRNQLKLKQQLIRKYK 140
            ||.|::.|.:|::|||
Mouse   117 LREQVRTKNELLQKYK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED9NP_788400.1 Med9 58..142 CDD:400090 27/81 (33%)
Med9NP_619616.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
Med9 60..132 CDD:284875 25/79 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838109
Domainoid 1 1.000 59 1.000 Domainoid score I10686
eggNOG 1 0.900 - - E1_2D40N
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5412
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008377
OrthoInspector 1 1.000 - - oto92553
orthoMCL 1 0.900 - - OOG6_109853
Panther 1 1.100 - - LDO PTHR20844
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4652
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.