DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED9 and Med9

DIOPT Version :10

Sequence 1:NP_788400.1 Gene:MED9 / 37079 FlyBaseID:FBgn0260401 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_619616.2 Gene:Med9 / 192191 MGIID:2183151 Length:142 Species:Mus musculus


Alignment Length:81 Identity:27/81 - (33%)
Similarity:51/81 - (62%) Gaps:10/81 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFESAREQIRQLPGIDFNKEEQQQRLEL 124
            ||:::::::|::||          |.|.:..:..|:.:|:..|:.|..:|||..:.|:|||:|..
Mouse    62 LPLVHNVIKCMDKD----------SPDLHQDLNALKTKFQELRKLIGTMPGIHVSPEQQQQQLHS 116

  Fly   125 LRNQLKLKQQLIRKYK 140
            ||.|::.|.:|::|||
Mouse   117 LREQVRTKNELLQKYK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED9NP_788400.1 Med9 58..142 CDD:462202 27/81 (33%)
Med9NP_619616.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
Med9-C 54..133 CDD:467847 27/81 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.