DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED9 and med9

DIOPT Version :9

Sequence 1:NP_788400.1 Gene:MED9 / 37079 FlyBaseID:FBgn0260401 Length:144 Species:Drosophila melanogaster
Sequence 2:XP_002667479.1 Gene:med9 / 100332528 ZFINID:ZDB-GENE-101021-2 Length:98 Species:Danio rerio


Alignment Length:85 Identity:32/85 - (37%)
Similarity:54/85 - (63%) Gaps:10/85 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DIEILPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFESAREQIRQLPGIDFNKEEQQQ 120
            |...||||:|:::|::||          |.|.:.::.:|:.:.:.|||||..:||||.:...|:.
Zfish    13 DYSFLPIIHDVIKCMDKD----------SPDVHQELNKLKTKIQEAREQISSMPGIDMSPAVQES 67

  Fly   121 RLELLRNQLKLKQQLIRKYK 140
            :|:.||.|::.|.||::|||
Zfish    68 KLQTLREQVQTKNQLLQKYK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED9NP_788400.1 Med9 58..142 CDD:400090 31/83 (37%)
med9XP_002667479.1 Med9 15..87 CDD:284875 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581929
Domainoid 1 1.000 67 1.000 Domainoid score I9885
eggNOG 1 0.900 - - E1_2D40N
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5331
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008377
OrthoInspector 1 1.000 - - oto40515
orthoMCL 1 0.900 - - OOG6_109853
Panther 1 1.100 - - LDO PTHR20844
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.