DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naus and YCR051W

DIOPT Version :9

Sequence 1:NP_001286565.1 Gene:Naus / 37076 FlyBaseID:FBgn0034308 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_009980.1 Gene:YCR051W / 850418 SGDID:S000000647 Length:222 Species:Saccharomyces cerevisiae


Alignment Length:87 Identity:23/87 - (26%)
Similarity:35/87 - (40%) Gaps:22/87 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 QRSDTIAEGLEEESKKSLRMEEELEKQTHAMEQERKVLFAKLAKEELRVKELEQELNALRSEHE- 361
            |....|...|.||.|.::|...|.:.:..|.|...:           |.::|||.:....:|.| 
Yeast   138 QGEGVIDSKLLEEFKDNVRYTLENDPEEGADEATLQ-----------RRRQLEQIITGDNAEEEL 191

  Fly   362 -----ALKKQQQLG-----GSG 373
                 |:.::|.||     |||
Yeast   192 ERYIRAMVREQMLGQGSMAGSG 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NausNP_001286565.1 CortBP2 78..274 CDD:286770
Angiomotin_C 189..381 CDD:289044 23/87 (26%)
YCR051WNP_009980.1 ANKYR 1..222 CDD:223738 23/87 (26%)
Ank_2 5..99 CDD:403870
ANK repeat 5..34 CDD:293786
ANK repeat 36..68 CDD:293786
ANK repeat 70..99 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3610
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.