DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naus and PPP1R16A

DIOPT Version :9

Sequence 1:NP_001286565.1 Gene:Naus / 37076 FlyBaseID:FBgn0034308 Length:609 Species:Drosophila melanogaster
Sequence 2:XP_024303079.1 Gene:PPP1R16A / 84988 HGNCID:14941 Length:582 Species:Homo sapiens


Alignment Length:354 Identity:66/354 - (18%)
Similarity:111/354 - (31%) Gaps:125/354 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 DLEEERAQVAKMEKDLKKLQETLEY-ERNRQKQIVLLLIAERKKILMKYIEEGKRSEDLAQILAE 295
            :|..|...|.:|     ..||.|:: ::.|.:|:.:...||::       .:||:...       
Human     6 ELLAEMPMVGRM-----STQERLKHAQKRRAQQVKMWAQAEKE-------AQGKKGPG------- 51

  Fly   296 EKQRSDTIAEGLEEESKKSLRMEEELEKQTHAMEQERKVLFAKLAKEELRVKELEQEL------- 353
            |:.|.:..::||.::                .:.....||....|:.:|  :|:.|.|       
Human    52 ERPRKEAASQGLLKQ----------------VLFPPSVVLLEAAARNDL--EEVRQFLGSGVSPD 98

  Fly   354 ----NALRSEHEAL-----KKQQQLGGSGSSVAAAKARQFSDDACATPPMVNIAKIVQPTATVSS 409
                :.|.:.|:..     :..|||..:|:::.|.      |..|.||        :...||...
Human    99 LANEDGLTALHQCCIDDFREMVQQLLEAGANINAC------DSECWTP--------LHAAATCGH 149

  Fly   410 MPVSGPQTGIARSIAPGQNIRSAGIATAPTGTATAAIAPLTAVLNHTTTITTTTNNTTTSSNSNS 474
            :.:      :...||.|.|:                             :...|:........:.
Human   150 LHL------VELLIASGANL-----------------------------LAVNTDGNMPYDLCDD 179

  Fly   475 SGSIGVAATAAAVAASVETAATVTVPMVAPPSPSPAKMQPTATIQRAPGGKYAALAAAAALDQTT 539
            ..::....||.|.......||...:|:..|.|..|.:..|.....| ||....|.|..       
Human   180 EQTLDCLETAMADRGRCGGAAVGGLPVALPLSLPPRRHHPGQHRGR-PGRARTAHAGR------- 236

  Fly   540 TPHPHPVPIAVPPVTVPPAGARGAPPPIP 568
              ||.            ||..||.||..|
Human   237 --HPE------------PAAGRGRPPCPP 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NausNP_001286565.1 CortBP2 78..274 CDD:286770 11/42 (26%)
Angiomotin_C 189..381 CDD:289044 31/165 (19%)
PPP1R16AXP_024303079.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3610
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.