DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naus and ppp1r16a

DIOPT Version :9

Sequence 1:NP_001286565.1 Gene:Naus / 37076 FlyBaseID:FBgn0034308 Length:609 Species:Drosophila melanogaster
Sequence 2:XP_001334473.1 Gene:ppp1r16a / 794494 ZFINID:ZDB-GENE-121214-252 Length:553 Species:Danio rerio


Alignment Length:536 Identity:96/536 - (17%)
Similarity:179/536 - (33%) Gaps:186/536 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ATATNGRTRSEMPHSELVKMLYYLEGELQA--------RDVCIAALRNERVKQLIAQLRTKRLQP 124
            |.||.|       |::||:||.....:|.|        .|:|......|.::.::|:....:.:.
Zfish   139 AAATCG-------HTDLVQMLIEAGADLLAVNADGNMPYDLCEDEATLELIEMIMAEQGITQEKI 196

  Fly   125 NDPYAAIFRDKIAL--------NG---NLISRESSTQ----AAQAEMEVRQ-IIEQQMEQQYQMV 173
            ::...|  ::::.|        ||   |:...:.:|.    ||...|.|.: ::|.::....:..
Zfish   197 DECRGA--KERVMLTDLREMVTNGADLNVKDEQGATMLHVAAANGYMSVGELLLEHRLSPDERDA 259

  Fly   174 SKQRATH-------VRMVNILTESLENNQRMLQELEEEKRKHENTTAQGDDITYGLELERNKLKQ 231
            ......|       ::||.:|                        .|.|..:....||:...|..
Zfish   260 DGWTPLHAAACWGQIQMVELL------------------------VAHGASLNAKSELDETPLDV 300

  Fly   232 DLEEE-RAQVAKM-----------EKDLKKLQETLEYERNRQKQIVLLLIAERKKILMKYIEEGK 284
            ..:|| ||::.::           :|....||..:....:|.|.:....:.||..:..:      
Zfish   301 CTDEEVRAKMMELKHKHDAIMKGQDKHKNTLQRRVSSTGSRGKVVRRSSVNERSSLYRR------ 359

  Fly   285 RSEDLAQILAEEKQRSDTIAEGLEEESKKSLRMEEELEKQTHAMEQERKVLFAKLAKEELRVKEL 349
                                     |.:|..::.:|..:||.|::.:..             ::.
Zfish   360 -------------------------EHQKEAKVWQERGRQTEALDDDED-------------RQT 386

  Fly   350 EQELNALRSEHEALKKQQQLGGSGSSVAAAKARQFSDDACATPPM-----VNIAKIVQPTATVSS 409
            :.|||.    |.:|..                   |.:|.|.||:     .|.|:::...:|.| 
Zfish   387 DAELNL----HASLMS-------------------SSNAIAVPPLDVGEVENGAQVIGNGSTGS- 427

  Fly   410 MPVSGP-QTGIARSIAPGQNIRSAGIATAPTGTATAAIAPLTAVLNHTTTITTTTNNTTTSSNSN 473
              .||. |:|       |...|||....:| |:|:|....::...:|.|.............|.:
Zfish   428 --FSGELQSG-------GLMDRSASYQLSP-GSASAGGDSMSRERSHHTLADLKRQRAAAKLNKH 482

  Fly   474 SSGSIGVAATAAAVAASVETAATVTVPMVAPPSPSPAKMQPTATIQR--APGGKYAALAA----- 531
            .:..:.:            :|.|...|:   |...|..::|:.::|:  ||...|...|:     
Zfish   483 PAPPLPL------------SAGTQDEPV---PEGPPGTLEPSESVQQVVAPNAVYFTQASGDPPL 532

  Fly   532 ----AAALDQTTTPHP 543
                |...:.|.|..|
Zfish   533 LKLKAPEEETTNTKEP 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NausNP_001286565.1 CortBP2 78..274 CDD:286770 42/238 (18%)
Angiomotin_C 189..381 CDD:289044 27/203 (13%)
ppp1r16aXP_001334473.1 Ank_2 71..163 CDD:289560 11/30 (37%)
ANK repeat 71..97 CDD:293786
ANK 94..281 CDD:238125 30/174 (17%)
ANK repeat 99..130 CDD:293786
ANK repeat 132..163 CDD:293786 11/30 (37%)
ANKYR 133..344 CDD:223738 43/237 (18%)
ANK repeat 227..258 CDD:293786 6/30 (20%)
ANK repeat 260..290 CDD:293786 6/53 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3610
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.