DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naus and LUZP1

DIOPT Version :9

Sequence 1:NP_001286565.1 Gene:Naus / 37076 FlyBaseID:FBgn0034308 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_001136018.1 Gene:LUZP1 / 7798 HGNCID:14985 Length:1076 Species:Homo sapiens


Alignment Length:696 Identity:129/696 - (18%)
Similarity:219/696 - (31%) Gaps:279/696 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 TKRLQPNDPYAAIFRDKIALNGNLISRESSTQAAQAEMEV-RQ--------------------II 162
            ||.||..:......:||:      |..|.|..:..||:|| ||                    ::
Human    34 TKNLQKAEDELLDLQDKV------IQAEGSNSSMLAEIEVLRQRVLRIEGKDEEIKRAEDLCRLM 92

  Fly   163 EQQMEQQYQMVSKQRATHVRMVNILTESLENNQRMLQELEEEKRKHENTTAQGDDITYGLELERN 227
            ::::|::..:..:.::.        .|.|:.....|::|||...:.:|...|   :...|..|||
Human    93 KEKLEEEENLTRELKSE--------IERLQKRMAELEKLEEAFSRSKNDCTQ---LCLSLNEERN 146

  Fly   228 ---KLKQDLEEERAQVAKMEKD---LKKLQETLEYERNRQKQIVLLLIAERKKILMKYIEEGKRS 286
               |:..:||..|.:|.::|..   |.|.:::|..|..:.|.:.|..::|||.:..|..|..|..
Human   147 LTKKISSELEMLRVKVKELESSEDRLDKTEQSLASELEKLKSLTLSFVSERKYLNEKEKENEKLI 211

  Fly   287 EDLAQILAEEKQRSDTIAEGLEEESKKSLRMEEELEKQTHAMEQERK--VLFAKLAKEELR---- 345
            ::|.|.|.:.|:.:...........:..||:|:.:.....:.|..||  :.:.|..:.|.|    
Human   212 KELTQKLEQNKKMNRDYTRNASNLERNDLRIEDGISSTLPSKESRRKGGLDYLKQVENETRNKSE 276

  Fly   346 -----------VKELEQELNALRS--------EHE------------------------------ 361
                       ||:|.||:..|::        |.|                              
Human   277 NEKNRNQEDNKVKDLNQEIEKLKTQIKHFESLEEELKKMKSKNNDLQDNYLSEQNKNKLLASQLE 341

  Fly   362 ----ALKKQQQL-------------------------GGSGSSVAAAKARQ-------------- 383
                .:|||::|                         .||.:||:...||:              
Human   342 EIKLQIKKQKELENGEVEGEDAFLSSKGRHERTKFRGHGSEASVSKHTARELSPQHKRERLRNRE 406

  Fly   384 ---------FSDDACATPPMVNIAKIVQPTATVSSMPV---SGPQ-------------------- 416
                     .|:...::|...|     :..|..|.|.|   ||.|                    
Human   407 FALNNENYSLSNRQVSSPSFTN-----RRAAKASHMGVSTDSGTQETKKTEDRFVPGSSQSEGKK 466

  Fly   417 -----TGIARSIAPGQNIRSAGIATAPTGTATAAIAPLTAVLNHTT-TITTTTNNT--------- 466
                 :.::|.....|....|...|:..||.:.    |...:..|| |.:.||:.:         
Human   467 SREQPSVLSRYPPAAQEHSKAWKGTSKPGTESG----LKGKVEKTTRTFSDTTHGSVPSDPLGRA 527

  Fly   467 -------------------------TTSSNSNSSGSIGVAA-----TAAAVAASVETAATVTVPM 501
                                     |.::||..|.:||..|     ::..::...:.|..:....
Human   528 DKASDTSSETVFGKRGHVLGNGSQVTQAANSGCSKAIGALASSRRSSSEGLSKGKKAANGLEADN 592

  Fly   502 VAPPSPSPAKM-------------------------QPTATIQ--------------RAPGGK-- 525
            ..|.|.:|...                         ||.|.:.              ::.|.:  
Human   593 SCPNSKAPVLSKYPYSCRSQENILQGFSTSHKEGVNQPAAVVMEDSSPHEALRCRVIKSSGREKP 657

  Fly   526 -------YAALAAAAALDQTTTPHPHPVPIAVPPVTVPPAGARGAP 564
                   .|:|..|..::.|.||.|.|.|   .|.:...|..||||
Human   658 DSDDDLDIASLVTAKLVNTTITPEPEPKP---QPNSREKAKTRGAP 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NausNP_001286565.1 CortBP2 78..274 CDD:286770 42/181 (23%)
Angiomotin_C 189..381 CDD:289044 59/281 (21%)
LUZP1NP_001136018.1 Lebercilin 104..303 CDD:292252 49/209 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..291 8/44 (18%)
mycoplas_twoTM 262..>369 CDD:275320 15/106 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 358..546 28/196 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 569..600 3/30 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 675..746 12/29 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 770..819
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 862..913
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 929..998
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1042..1076
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23166
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.