Sequence 1: | NP_001286565.1 | Gene: | Naus / 37076 | FlyBaseID: | FBgn0034308 | Length: | 609 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001345862.1 | Gene: | Ppp1r16a / 73062 | MGIID: | 1920312 | Length: | 524 | Species: | Mus musculus |
Alignment Length: | 267 | Identity: | 50/267 - (18%) |
---|---|---|---|
Similarity: | 99/267 - (37%) | Gaps: | 83/267 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 218 ITYGLELERNKLKQDL-------EEERAQVAKMEKDLKKLQETLEYERNRQKQIV---LLLIAER 272
Fly 273 KKILMKYIEEGKRSEDLAQILAEE----KQRSDTIAEGLEEESKKS---LRMEEELE-------- 322
Fly 323 ----------KQTHAMEQERKVLFAKLAKEELRVKELEQELNALRSEHEALKKQQQLGGSGSSVA 377
Fly 378 AAKARQFSDDACATPPMVNIAKIVQPTATVSSMPVSGPQTGIARSIAPGQNIRSAGIATAPTGTA 442
Fly 443 TAAIAPL 449 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Naus | NP_001286565.1 | CortBP2 | 78..274 | CDD:286770 | 14/65 (22%) |
Angiomotin_C | 189..381 | CDD:289044 | 35/197 (18%) | ||
Ppp1r16a | NP_001345862.1 | ANK 1 | 70..99 | ||
ANK repeat | 74..101 | CDD:293786 | |||
ANK | 98..285 | CDD:238125 | 50/267 (19%) | ||
ANK repeat | 103..134 | CDD:293786 | |||
ANK 2 | 103..132 | ||||
ANK repeat | 136..167 | CDD:293786 | |||
ANK 3 | 136..165 | ||||
ANKYR | 138..328 | CDD:223738 | 11/46 (24%) | ||
ANK repeat | 231..262 | CDD:293786 | |||
ANK 4 | 231..260 | ||||
ANK 5 | 264..293 | 2/7 (29%) | |||
ANK repeat | 264..292 | CDD:293786 | 1/6 (17%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 368..421 | 9/52 (17%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 462..524 | 14/67 (21%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3610 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |