DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naus and Filip1

DIOPT Version :9

Sequence 1:NP_001286565.1 Gene:Naus / 37076 FlyBaseID:FBgn0034308 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_001344281.1 Gene:Filip1 / 70598 MGIID:1917848 Length:1229 Species:Mus musculus


Alignment Length:382 Identity:101/382 - (26%)
Similarity:179/382 - (46%) Gaps:48/382 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EQNSN--------SSVADTFAEAPATDADYGTENCSGSGMSVGDTVSANHEFQTMKPGPGVVHKV 58
            |.:||        |.::....:.|:.||.....|..|.     |.|.|:          |.|.:.
Mouse    24 ESSSNGHVSCPKPSIISSDGGKGPSEDAKKNKANRKGE-----DDVMAS----------GTVKRH 73

  Fly    59 MPVANSASSATATNGRTRSEMPHSELVKMLYYLEGELQARDVCIAALRNERVKQLIAQLRTKRLQ 123
            :..:..:...|    :...|:...:|:::|..:|||||||:..|..|:.|:.|..:.:......:
Mouse    74 LKPSGESEKKT----KKPLELSKEDLIQLLSIMEGELQAREDVIHMLKTEKTKPEVLEAHYGSAE 134

  Fly   124 PNDPYAAIFRDKIALNGNLISRESSTQAAQAEMEVRQIIEQQMEQQYQMVSKQRATHVRMVNILT 188
            |......:.||.|              .||.:.....:.|:.:.:..::..||:.|:.||:..|.
Mouse   135 PEKVLRVLHRDAI--------------LAQEKSIGEDVYEKPISELDRLEEKQKETYRRMLEQLL 185

  Fly   189 ESLENNQRMLQELEEEKRKHENTTAQGDDITYGLELERNKLKQDLEEERAQVAKMEKDLKKLQET 253
            .:.:.::|.:.|||.||.||.:...:.||.|..||.||.:||:.||:|:|..|:.||:..|....
Mouse   186 LAEKCHRRTVYELENEKHKHTDYMNKSDDFTNLLEQERERLKKLLEQEKAYQARKEKENAKRLNK 250

  Fly   254 LEYERNRQKQIVLLLIAERKKILMKYIEEGKRSEDLAQILAEEKQRSDTIAEGLEEESKKSLRME 318
            |..|..:.|...|:|:.||:..:.:...:.::.:||.|.|.||:::...|....:|:.:|.|::|
Mouse   251 LRDELVKLKSFALMLVDERQMHIEQLGLQSQKVQDLTQKLREEEEKLKAITYKSKEDRQKLLKLE 315

  Fly   319 EELEKQTHAMEQERKVLFAKLAKEE-----LRVK--ELEQELNALRSEHEALKKQQQ 368
            .:.|.:.....||.:.:.||||.:|     ||:|  .|.|.:..|...:::|:|.::
Mouse   316 VDFEHKASRFSQEHEEMNAKLANQESHNRQLRLKLVGLSQRIEELEETNKSLQKAEE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NausNP_001286565.1 CortBP2 78..274 CDD:286770 59/195 (30%)
Angiomotin_C 189..381 CDD:289044 59/187 (32%)
Filip1NP_001344281.1 CortBP2 89..270 CDD:313023 58/194 (30%)
SMC_N <220..753 CDD:330553 47/153 (31%)
PLN03209 <970..1183 CDD:178748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23166
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.