DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naus and fam184ab

DIOPT Version :9

Sequence 1:NP_001286565.1 Gene:Naus / 37076 FlyBaseID:FBgn0034308 Length:609 Species:Drosophila melanogaster
Sequence 2:XP_683302.2 Gene:fam184ab / 555640 ZFINID:ZDB-GENE-041014-214 Length:1145 Species:Danio rerio


Alignment Length:427 Identity:91/427 - (21%)
Similarity:177/427 - (41%) Gaps:108/427 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MKPGPGVVHKVMPVANSAS----SATATNGRTRSEMPH------------------SELVKMLYY 90
            |..|.|..|...| |.|||    ::|:|:..|.:..|.                  ::|.|::|.
Zfish     1 MATGAGWQHYYNP-AGSASTGKYNSTSTSTSTSTSFPSGLTLEYTQDLHLKMSKKIAQLTKVIYA 64

  Fly    91 LEGELQARDVCIAALR---NERVKQLIAQLRTKRLQPNDPYAAIFRDKIALNGNLISRESSTQAA 152
            |..:....:..|..|:   .|.|:|::::.|.|.:|    |.:...|::.|...:.|.|.|    
Zfish    65 LNTKNDEHEAAIQTLKEAHEEEVQQILSETREKIMQ----YKSKISDEMDLKRRIQSLEES---- 121

  Fly   153 QAEMEVRQIIEQQMEQQYQMVSKQR---------ATHVRMVNILTESLENNQRMLQE-------- 200
               ||:.:.:::|...::: ..:||         |.|.:.|..::..:|..:|..:|        
Zfish   122 ---MELHERMKRQALDEFE-TYRQRVEDMQLCTEAQHTQRVVSMSREVEEMRRSFEEKLRSFAQL 182

  Fly   201 ---LEEEKRKHENTTAQGDDITYGLELERNKLKQDLEEERAQVAKMEKDLKKLQETLEYERNRQK 262
               .|:|||:.......|         .|.::::.|...::|.|...||.:||.:..:.|.:...
Zfish   183 QSQFEQEKRQALEELRSG---------HRQEVQELLRSHQSQNANYSKDQEKLGQLHKAEVDSLN 238

  Fly   263 QIVLLLIAERKKILMKY--------------IEEGKRSEDLA--QILAEEKQRSDTIAEGLEEES 311
            :.|..|..::|:::.:|              :|..||::.:.  .:||.:|..::...|...:|:
Zfish   239 ERVEELKQDKKRLVEEYEAKLNKAQAFYERELEAMKRTQQMTAENLLAWKKTEAELRKEFQAQEA 303

  Fly   312 --KKSL-RMEEELEK-QTHAMEQERK--VLFAKLAKEELRVKELEQELNALRSEHEALKKQQQLG 370
              :|:| ::..||:: |..|.|...|  .|.|.|...|..:|||.::|..:..:.|.::.:|:.|
Zfish   304 ALQKTLGKLRSELQRVQDEARESREKSHKLQASLMTAENNIKELHKQLEEVTKDAEIVEIRQREG 368

  Fly   371 G-------------------SGSSVAAAKARQFSDDA 388
            .                   ..|.:.:.:|.|.:.:|
Zfish   369 ECELEASRDRVQQQATEILLKASQIGSLQATQMTHEA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NausNP_001286565.1 CortBP2 78..274 CDD:286770 46/236 (19%)
Angiomotin_C 189..381 CDD:289044 49/243 (20%)
fam184abXP_683302.2 FAM184 61..271 CDD:292293 45/230 (20%)
Smc 239..1016 CDD:224117 35/167 (21%)
LCD1 776..>886 CDD:286837
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.