DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naus and Filip1l

DIOPT Version :9

Sequence 1:NP_001286565.1 Gene:Naus / 37076 FlyBaseID:FBgn0034308 Length:609 Species:Drosophila melanogaster
Sequence 2:XP_017453601.1 Gene:Filip1l / 304020 RGDID:1565927 Length:1224 Species:Rattus norvegicus


Alignment Length:374 Identity:88/374 - (23%)
Similarity:165/374 - (44%) Gaps:77/374 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FQTMKPGPGVVHKVM--------------PVANSASSATATNGRTRSEMPHSELVKMLYYLEGEL 95
            ||.||      |:..              ||:..:.|.   .|....::...:|:.:|..|||||
  Rat    26 FQDMK------HRAQKRDPSSESEEALPCPVSEKSCSG---KGHQTEDLSRDDLLFLLSILEGEL 81

  Fly    96 QARDVCIAALRNERVKQLIAQLRTKRLQPNDPYAAIFRDKIALNGNLISRESSTQAAQAEMEVRQ 160
            ||||..|..||.|::...:.:.....:.|.....|:.||             :.|...|..: ..
  Rat    82 QARDEVIGILRAEKIDLALLEAHYGFVTPKKVLEALQRD-------------AFQVKSAPWQ-ED 132

  Fly   161 IIEQQMEQQYQMVSKQRATHVRMVNILTESLENNQRMLQELEEEKRKHENTTAQGDDITYGLELE 225
            |.|:.|.:..:::.|.:.:..|:|..|....:::::.:.|:|||||||:....:.|:....||.|
  Rat   133 IYEKPMNELDKVIEKHKDSDRRIVEQLLMVEKSHRQTIMEMEEEKRKHKEYMERSDEFINLLEQE 197

  Fly   226 RNK--------------------------------------LKQDLEEERAQVAKMEKDLKKLQE 252
            ..:                                      ||:.:::|.....|.|::.:|..:
  Rat   198 CERIFPSPCSGEPQEECKSNTKNAVKRTDEILREEYKTLTGLKKLIDQETESQEKKEQEKEKRIK 262

  Fly   253 TLEYERNRQKQIVLLLIAERKKILMKYIEEGKRSEDLAQILAEEKQRSDTIAEG-LEEESKKSLR 316
            .|:.|..:.|...|:::.|::::..:...:.::.:||| ..|:|.|....:||. .:||.:|:.|
  Rat   263 ALKEELTKLKSFALMVVDEQQRLTAQLALQRQKIQDLA-TSAKETQGKLAVAEARAQEEEQKAAR 326

  Fly   317 MEEELEKQTHAMEQERKVLFAKLAKEELRVKELEQELNALRSEHEALKK 365
            :|:||:.||...:|.:..:.|||..|:.:.::|.|:|.||..:.:.|::
  Rat   327 LEKELQTQTTEFQQNQDKIMAKLTNEDSQNRQLRQKLAALSRQIDELEE 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NausNP_001286565.1 CortBP2 78..274 CDD:286770 51/233 (22%)
Angiomotin_C 189..381 CDD:289044 51/216 (24%)
Filip1lXP_017453601.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23166
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.