DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naus and FILIP1

DIOPT Version :9

Sequence 1:NP_001286565.1 Gene:Naus / 37076 FlyBaseID:FBgn0034308 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_001276916.1 Gene:FILIP1 / 27145 HGNCID:21015 Length:1216 Species:Homo sapiens


Alignment Length:298 Identity:86/298 - (28%)
Similarity:152/298 - (51%) Gaps:21/298 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EMPHSELVKMLYYLEGELQARDVCIAALRNERVKQLIAQLRTKRLQPNDPYAAIFRDKIALNGNL 142
            |:...:|:::|..:|||||||:..|..|:.|:.|..:.:......:|......:.||.|      
Human    77 ELSKEDLIQLLSIMEGELQAREDVIHMLKTEKTKPEVLEAHYGSAEPEKVLRVLHRDAI------ 135

  Fly   143 ISRESSTQAAQAEMEVRQIIEQQMEQQYQMVSKQRATHVRMVNILTESLENNQRMLQELEEEKRK 207
                    .||.:.....:.|:.:.:..::..||:.|:.||:..|..:.:.::|.:.|||.||.|
Human   136 --------LAQEKSIGEDVYEKPISELDRLEEKQKETYRRMLEQLLLAEKCHRRTVYELENEKHK 192

  Fly   208 HENTTAQGDDITYGLELERNKLKQDLEEERAQVAKMEKDLKKLQETLEYERNRQKQIVLLLIAER 272
            |.:...:.||.|..||.||.:||:.||:|:|..|:.||:..|....|..|..:.|...|:|:.||
Human   193 HTDYMNKSDDFTNLLEQERERLKKLLEQEKAYQARKEKENAKRLNKLRDELVKLKSFALMLVDER 257

  Fly   273 KKILMKYIEEGKRSEDLAQILAEEKQRSDTIAEGLEEESKKSLRMEEELEKQTHAMEQERKVLFA 337
            :..:.:...:.::.:||.|.|.||:::...|....:|:.:|.|::|.:.|.:.....||.:.:.|
Human   258 QMHIEQLGLQSQKVQDLTQKLREEEEKLKAITSKSKEDRQKLLKLEVDFEHKASRFSQEHEEMNA 322

  Fly   338 KLAKEE-----LRVK--ELEQELNALRSEHEALKKQQQ 368
            |||.:|     ||:|  .|.|.:..|...::.|:|.::
Human   323 KLANQESHNRQLRLKLVGLTQRIEELEETNKNLQKAEE 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NausNP_001286565.1 CortBP2 78..274 CDD:286770 59/195 (30%)
Angiomotin_C 189..381 CDD:289044 59/187 (32%)
FILIP1NP_001276916.1 CortBP2 77..258 CDD:286770 58/194 (30%)
PRK03918 <208..741 CDD:235175 47/153 (31%)
RILP-like <262..364 CDD:304877 27/99 (27%)
DUF972 389..>461 CDD:283750
RILP-like <428..532 CDD:304877
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23166
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.