DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naus and SPCP1E11.10

DIOPT Version :9

Sequence 1:NP_001286565.1 Gene:Naus / 37076 FlyBaseID:FBgn0034308 Length:609 Species:Drosophila melanogaster
Sequence 2:NP_588563.1 Gene:SPCP1E11.10 / 2538792 PomBaseID:SPCP1E11.10 Length:207 Species:Schizosaccharomyces pombe


Alignment Length:152 Identity:30/152 - (19%)
Similarity:63/152 - (41%) Gaps:37/152 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 HSELVKMLYYLEGELQARD--------VC-IAALRNERVKQLIAQLRTKRLQPNDPYAAIFRDKI 136
            ||:|:|:|....|::..||        || ...:.::.:.|..|....|.   ||  ..|....|
pombe    49 HSDLLKILVERGGDINIRDQDGETPLFVCEKLEIAHDLINQYNADTTVKN---ND--GLIAAQVI 108

  Fly   137 ALNG-------------NLISRESSTQAAQAEMEVRQII-EQQMEQQ--YQMVSKQRATHVRMVN 185
            ..||             :|..::.:|.....::|..::: ||:|:::  ..::.::....:..:.
pombe   109 EANGEFPELAKYLYSFTDLEPKDVNTLPNDTKIEYAKLMTEQEMDEEAGQPLLDQKAKAEIDRIL 173

  Fly   186 ILTESLENNQRMLQELEEEKRK 207
            .|.::..|       :::|.||
pombe   174 ALRDTGVN-------VDDELRK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NausNP_001286565.1 CortBP2 78..274 CDD:286770 30/152 (20%)
Angiomotin_C 189..381 CDD:289044 4/19 (21%)
SPCP1E11.10NP_588563.1 ANK repeat 5..34 CDD:293786
Ank_2 8..98 CDD:289560 12/48 (25%)
ANK 10..121 CDD:238125 19/76 (25%)
ANK repeat 36..67 CDD:293786 6/17 (35%)
ANK repeat 69..98 CDD:293786 4/28 (14%)
ANK repeat 100..131 CDD:293786 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3610
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.