DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naus and Filip1

DIOPT Version :9

Sequence 1:NP_001286565.1 Gene:Naus / 37076 FlyBaseID:FBgn0034308 Length:609 Species:Drosophila melanogaster
Sequence 2:XP_017450956.1 Gene:Filip1 / 246776 RGDID:628597 Length:1227 Species:Rattus norvegicus


Alignment Length:404 Identity:103/404 - (25%)
Similarity:183/404 - (45%) Gaps:59/404 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EQNSN--------SSVADTFAEAPATDADYGTENCSGSGMSVGDTVSANHEFQTMKPGPGVVHKV 58
            |.:||        |.::....:.|:.||.....|.....:....|:..:     :||        
  Rat    24 ESSSNGHVSCPKSSIISSDGGKGPSEDAKKNKANRKEEDVMASGTIKRH-----LKP-------- 75

  Fly    59 MPVANSASSATATNGRTRSEMPHSELVKMLYYLEGELQARDVCIAALRNERVKQLIAQLRTKRLQ 123
                 |..|...|  :...|:...:|:::|..:|||||||:..|..||.|:.|..:.:......:
  Rat    76 -----SGESEKKT--KKSVELSKEDLIQLLSIMEGELQAREDVIHMLRTEKTKPEVLEAHYGSAE 133

  Fly   124 PNDPYAAIFRDKIALNGNLISRESSTQAAQAEMEVRQIIEQQMEQQYQMVSKQRATHVRMVNILT 188
            |......:.||.|              .||.:.....:.|:.:.:..::..||:.|:.||:..|.
  Rat   134 PEKVLRVLHRDAI--------------LAQEKSIGEDVYEKPISELDRLEEKQKETYRRMLEQLL 184

  Fly   189 ESLENNQRMLQELEEEKRKHENTTAQGDDITYGLELERNKLKQDLEEERAQVAKMEKDLKKLQET 253
            .:.:.::|.:.|||.||.||.:...:.||.|..||.||.:||:.||:|:|..|:.||:..|....
  Rat   185 LAEKCHRRTVYELENEKHKHTDYMNKSDDFTNLLEQERERLKKLLEQEKAYQARKEKENAKRLNK 249

  Fly   254 LEYERNRQKQIVLLLIAERKKILMKYIEEGKRSEDLAQILAEEKQRSDTIAEGLEEESKKSLRME 318
            |..|..:.|...|:|:.||:..:.:...:.::.:||.|.|.||:::...:....:|:.:|.|::|
  Rat   250 LRDELVKLKSFALMLVDERQMHIEQLGLQSQKVQDLTQKLREEEEKLKAVTYKSKEDRQKLLKLE 314

  Fly   319 EELEKQTHAMEQERKVLFAKLAKEE--------------LRVKELEQELNALRSEHEALKKQQQ- 368
            .:.|.:.....||.:.:.||||.:|              .|::|||:...:|:...|.|::.:: 
  Rat   315 VDFEHKASRFSQEHEEMNAKLANQESHNRQLRLKLVGLSQRIEELEETNKSLQKAEEELQELREK 379

  Fly   369 --LGGSGSSVAAAK 380
              .|..|:|...|:
  Rat   380 IAKGECGNSSLMAE 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NausNP_001286565.1 CortBP2 78..274 CDD:286770 60/195 (31%)
Angiomotin_C 189..381 CDD:289044 61/209 (29%)
Filip1XP_017450956.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23166
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.