| Sequence 1: | NP_001286565.1 | Gene: | Naus / 37076 | FlyBaseID: | FBgn0034308 | Length: | 609 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001153134.1 | Gene: | Ppp1r16b / 228852 | MGIID: | 2151841 | Length: | 568 | Species: | Mus musculus |
| Alignment Length: | 231 | Identity: | 43/231 - (18%) |
|---|---|---|---|
| Similarity: | 76/231 - (32%) | Gaps: | 86/231 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 161 IIEQQMEQQYQMVSKQRATHVRMVNILTESLENNQRMLQELEEEKRKHENTTAQGDDITYGLELE 225
Fly 226 RNKLKQDLEEERAQVAKMEKDLKKLQETLEYERNRQ----------------------KQIVLLL 268
Fly 269 IAERK-------------------------KILMKYIEEGKRSEDLAQI---------LAEEKQR 299
Fly 300 SDTIA-----EGLEEESKKSLRM--EEELEKQTHAM 328 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Naus | NP_001286565.1 | CortBP2 | 78..274 | CDD:286770 | 27/159 (17%) |
| Angiomotin_C | 189..381 | CDD:289044 | 38/203 (19%) | ||
| Ppp1r16b | NP_001153134.1 | PHA03095 | 71..>301 | CDD:222980 | 25/151 (17%) |
| ANK repeat | 71..98 | CDD:293786 | 5/26 (19%) | ||
| Ank_2 | 72..164 | CDD:372319 | 14/97 (14%) | ||
| ANK repeat | 100..131 | CDD:293786 | 4/30 (13%) | ||
| ANK 1 | 100..129 | 4/28 (14%) | |||
| ANK repeat | 133..164 | CDD:293786 | 6/36 (17%) | ||
| ANK 2 | 133..162 | 6/34 (18%) | |||
| ANK repeat | 166..259 | CDD:293786 | 10/50 (20%) | ||
| ANK 3 | 228..257 | ||||
| ANK repeat | 261..292 | CDD:293786 | |||
| ANK 4 | 261..290 | ||||
| ANK repeat | 294..318 | CDD:293786 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 373..403 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 505..527 | ||||
| ANK 5 | 531..560 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3610 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.030 | |||||