DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and NOG2

DIOPT Version :9

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_014451.1 Gene:NOG2 / 855789 SGDID:S000005336 Length:486 Species:Saccharomyces cerevisiae


Alignment Length:308 Identity:67/308 - (21%)
Similarity:108/308 - (35%) Gaps:85/308 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 HYSSVLETKIKPSFSIPETQQHLPDDWMD-------------DYEFYQGAQEGGNKQGTPDPSLP 103
            |:.|.|....|.::.:...:..||...::             |.|.|  |...|.|.....|.|.
Yeast    91 HFRSALGETQKDTYQVLLRRNKLPMSLLEEKDADESPKARILDTESY--ADAFGPKAQRKRPRLA 153

  Fly   104 ASKVPCNGCGADL-HCTNASLPGYIPSEIFRDRT------QQELQ---TITCKRCHFLNHYNIAL 158
            ||.:      .|| ..||..:..|...::. |.|      |::.:   |...|...|....:   
Yeast   154 ASNL------EDLVKATNEDITKYEEKQVL-DATLGLMGNQEDKENGWTSAAKEAIFSKGQS--- 208

  Fly   159 DVVVAPSTYVDTISRIQDKFALAIVLVDLLDFP----C-SIWPGMQNILGAKRPVFLVGNKVDLL 218
                  ....:.:.::.|...:.|.::|..| |    | |:...|:.....|..:::: ||.||:
Yeast   209 ------KRIWNELYKVIDSSDVVIHVLDARD-PLGTRCKSVEEYMKKETPHKHLIYVL-NKCDLV 265

  Fly   219 PRDSNIYLQHIKDSLQREFIKHGGGNGLNIKNVSL---ISAKTGYGIEELI------TQLHKTWA 274
            |           ..:...::||     |:.:..:|   .|....:|...||      :||| |..
Yeast   266 P-----------TWVAAAWVKH-----LSKERPTLAFHASITNSFGKGSLIQLLRQFSQLH-TDR 313

  Fly   275 YKGDVYLVGCTNVGKSSLFNILLNSDYCRPEASDLVRKATTCPWPGTT 322
            .:..|..:|..|.||||:.|.|.....|:           ..|.||.|
Yeast   314 KQISVGFIGYPNTGKSSIINTLRKKKVCQ-----------VAPIPGET 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 51/238 (21%)
YqeH 145..332 CDD:206748 42/192 (22%)
NOG2NP_014451.1 NGP1NT 41..171 CDD:400461 20/87 (23%)
NGP_1 214..370 CDD:206751 40/167 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.