DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and LSG1

DIOPT Version :9

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_011416.3 Gene:LSG1 / 852779 SGDID:S000003067 Length:640 Species:Saccharomyces cerevisiae


Alignment Length:350 Identity:71/350 - (20%)
Similarity:104/350 - (29%) Gaps:156/350 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 RIQDKFALAIVLVDLLDFPCSIWPGMQNILGAKRPV---------FLVGNKVDLLPRDSNIYLQH 228
            |:.::..|.:.:||..:      |.:...:..:|.|         .|:.||.|||.:...|    
Yeast   193 RVVERSDLVVQIVDARN------PLLFRSVDLERYVKESDDRKANLLLVNKADLLTKKQRI---- 247

  Fly   229 IKDSLQREFIKHGGGNGLNIKNVSLI----------------------------SAKTGYGIEE- 264
               :..:.||.         ||:|..                            :.|.|:..:| 
Yeast   248 ---AWAKYFIS---------KNISFTFYSALRANQLLEKQKEMGEDYREQDFEEADKEGFDADEK 300

  Fly   265 --------LITQLHKTWAYKG----------------DVYLVGCTNVGKSSLFNILLNSDYCRPE 305
                    .|.||.:.:..|.                ::.|||..||||||..|.|:.:      
Yeast   301 VMEKVKILSIDQLEELFLSKAPNEPLLPPLPGQPPLINIGLVGYPNVGKSSTINSLVGA------ 359

  Fly   306 ASDLVRKATTCPWPG-----TTLKL-----------LRFP-------------ILRPSNDRVYQR 341
                 :|.:....||     .|:||           |.||             :|.....|.|..
Yeast   360 -----KKVSVSSTPGKTKHFQTIKLSDSVMLCDCPGLVFPNFAYNKGELVCNGVLPIDQLRDYIG 419

  Fly   342 FKRLVSERSEKAEMEKERRAVARETGSAAAAQPVAPVG---RTFDRRENLHDAFAMAGGSRPITT 403
            ...||:||..|..:|                   |..|   :|..|.|         ||:..|.|
Yeast   420 PAGLVAERIPKYYIE-------------------AIYGIHIQTKSRDE---------GGNGDIPT 456

  Fly   404 LNDRGKEYKEARWVYDTPGVMQPDQ 428
            ..:....|..||. |.|.|....|:
Yeast   457 AQELLVAYARARG-YMTQGYGSADE 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 71/349 (20%)
YqeH 145..332 CDD:206748 46/249 (18%)
LSG1NP_011416.3 RbgA 167..528 CDD:224083 71/349 (20%)
HSR1_MMR1 187..394 CDD:206750 44/233 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.