DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and EMB3129

DIOPT Version :10

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_192188.2 Gene:EMB3129 / 828174 AraportID:AT4G02790 Length:372 Species:Arabidopsis thaliana


Alignment Length:200 Identity:54/200 - (27%)
Similarity:78/200 - (39%) Gaps:59/200 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 PSTYVDTISRIQDKFALAIVLVDLLD--FPCS-IWPGMQNILGAKRPVFLVGNKVDLLPRDSNIY 225
            |...:.|...::::..|..|::::.|  .|.| ..|.|...||.::.: ||.|:.|::..|.   
plant   100 PGHIMKTEKELREQLKLMDVVIEVRDARIPLSTTHPKMDAWLGNRKRI-LVLNREDMISNDD--- 160

  Fly   226 LQHIKDSLQREFIKHGGGNGLNIKNVSLISAKTGYGIEELITQLHKTWAYKGDVY---------- 280
                ::...|.|.|.|      || |...:.|.|.|..:| .:|.|:.|  |||.          
plant   161 ----RNDWARYFAKQG------IK-VIFTNGKLGMGAMKL-GRLAKSLA--GDVNGKRREKGLLP 211

  Fly   281 ------LVGCTNVGKSSLFNILLNSDYCRPEASDLVRKATTCPWPGTT-----------LKLLRF 328
                  ::|..|||||||.|.||....|           ...|.||.|           |.||..
plant   212 RSVRAGIIGYPNVGKSSLINRLLKRKIC-----------AAAPRPGVTREMKWVKLGKDLDLLDS 265

  Fly   329 PILRP 333
            |.:.|
plant   266 PGMLP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 53/199 (27%)
YqeH 145..332 CDD:206748 53/197 (27%)
EMB3129NP_192188.2 GTPase_YlqF 97..368 CDD:274669 53/199 (27%)

Return to query results.
Submit another query.