DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and gnl1

DIOPT Version :9

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_001070721.1 Gene:gnl1 / 568505 ZFINID:ZDB-GENE-060323-1 Length:602 Species:Danio rerio


Alignment Length:304 Identity:59/304 - (19%)
Similarity:96/304 - (31%) Gaps:128/304 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 RIQDKFALAIVLVDL----LDFPCSIWPGMQNILGAKRPVFLVGNKVDLLP-------RDSNIYL 226
            |:.:...:.:::||:    |.||.:::..:...|  |:.:.||.||.||.|       :|   ||
Zfish   179 RVIEMSDVILLIVDIRHPVLQFPPALYHYITEEL--KKHIILVLNKADLCPAPLVLAWKD---YL 238

  Fly   227 -----------------QHIKDSLQREFIK------HGGG--------NGLNIKNVSLIS----- 255
                             |.....||::.::      |.||        ..:....|.|.|     
Zfish   239 TKQFPHLHCVCFTSHPGQPYSTLLQKKRMRKKAGWNHAGGPIHIMRVCQEITAGRVDLSSWEKKI 303

  Fly   256 -----------AKTGYGIEELITQLHKTWA----------YKGDVYLVGC---TNVGKSSLFNIL 296
                       .:...|.|.::.:.|...|          ||..|..:||   .||||||:.|.|
Zfish   304 QRDAVAVGNEGDRADDGSESVLMEHHSDIAMEMNSPTQELYKDGVLTLGCIGFPNVGKSSVLNSL 368

  Fly   297 L-----------------NSDYCRPEASDLVRKATTCPWPGTTLKLLRFPILRPSNDRVYQRFKR 344
            :                 .:.|..|...       .|..||     |.||               
Zfish   369 VGRKVVSVSRTPGHTKYFQTYYLTPTVK-------LCDCPG-----LVFP--------------- 406

  Fly   345 LVSERSEKAEMEKERRAVARETGSAAAAQPVAPVGRTFDRRENL 388
                    :.::|:.:.:|.....:...:|.:.||...:|...|
Zfish   407 --------SRVDKQLQVLAGIYPVSQLQEPYSSVGHLCERTNYL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 59/304 (19%)
YqeH 145..332 CDD:206748 52/246 (21%)
gnl1NP_001070721.1 HSR1_MMR1 173..406 CDD:206750 50/243 (21%)
rbgA 175..508 CDD:236570 59/304 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.