DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and Pigp

DIOPT Version :9

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_001153089.1 Gene:Pigp / 56176 MGIID:1860433 Length:205 Species:Mus musculus


Alignment Length:94 Identity:20/94 - (21%)
Similarity:30/94 - (31%) Gaps:35/94 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 GGGNGLNIKN---------------------VSLISAKTGYGI--------EELITQL------H 270
            ||..||.:..                     |..:|::.|:.:        |..:..|      .
Mouse    60 GGSRGLGLSKATGKMVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFVPESWLNSLGLTYWPQ 124

  Fly   271 KTWAYKGDVYLVGCTNVGKSSLFNILLNS 299
            |.||....|||:....:|...||.|.:.|
Mouse   125 KYWAVALPVYLLITVVIGYVLLFGINMMS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 20/94 (21%)
YqeH 145..332 CDD:206748 20/94 (21%)
PigpNP_001153089.1 PIG-P 84..197 CDD:285682 16/70 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R779
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.