DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10914 and LSG1

DIOPT Version :9

Sequence 1:	NP_611297.3	Gene:	CG10914 / 37075	FlyBaseID:	FBgn0034307	Length:	624	Species:	Drosophila melanogaster
Sequence 2:	NP_060855.2	Gene:	LSG1 / 55341	HGNCID:	25652	Length:	658	Species:	Homo sapiens

Alignment Length:	78	Identity:	24/78 - (30%)
Similarity:	33/78 - (42%)	Gaps:	16/78 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   248 IKNVSLISAKTGYGIEELITQLHKTWAYKG---DVYLVGCTNVGKSSLFNILLNSDYCRPEASDL 309
            |.|.|.:.:|  ..:.||..:||.....|.   .|.|||..||||||..|.::.:
Human   357 IHNFSHLVSK--QELLELFKELHTGRKVKDGQLTVGLVGYPNVGKSSTINTIMGN---------- 409

  Fly   310 VRKATTCPWPGTT 322
             :|.:....||.|
Human   410 -KKVSVSATPGHT 421

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10914	NP_611297.3	GTPase_YqeH	109..596	CDD:213834	24/78 (31%)
CG10914	NP_611297.3	YqeH	145..332	CDD:206748	24/78 (31%)
LSG1	NP_060855.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..31
		RbgA	151..554	CDD:224083	24/78 (31%)
		HSR1_MMR1	163..444	CDD:206750	24/78 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	250..355
		P-loop_NTPase	366..>404	CDD:304359	16/39 (41%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	623..658
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1161
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900