DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and Ns1

DIOPT Version :9

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_732199.2 Gene:Ns1 / 42060 FlyBaseID:FBgn0038473 Length:581 Species:Drosophila melanogaster


Alignment Length:240 Identity:59/240 - (24%)
Similarity:96/240 - (40%) Gaps:42/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 EIFR-DRTQQELQTITC--------KRCHFLNHYNIALD---------VVVAPS--TYVDTISRI 174
            |.|: :|.|.:.:|:..        ...|.:.|.|.|.|         |....|  .|.....::
  Fly    83 EAFKAEREQNKFKTLESMVEDADMRSTVHGIMHENDAQDQDEKKYKNAVTKEQSLKQYFKEFRKV 147

  Fly   175 QDKFALAIVLVDLLDFP----CS-IWPGMQNILGAKRPVFLVGNKVDLLPRDS-NIYLQH----- 228
            .:...:.:.:||..| |    |: :...::...|.||.| ||.||.||:||:: |.::::     
  Fly   148 IENADVVLEVVDARD-PLGTRCNEVERAVRGAPGNKRLV-LVLNKADLVPRENLNNWIKYFRRSG 210

  Fly   229 ----IKDSLQREFIKHGGGNGLNIKNVSLISAKTGYGIEELITQLHKTWAYKG-----DVYLVGC 284
                .|.|.|.:..:.|......:|....:......|.|.|::.|......||     .|.:||.
  Fly   211 PVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAELLMSMLGNYCRNKGIKTSIRVGVVGI 275

  Fly   285 TNVGKSSLFNILLNSDYCRPEASDLVRKATTCPWPGTTLKLLRFP 329
            .||||||:.|.|.....|...::..|.|:.......:.:||:..|
  Fly   276 PNVGKSSIINSLTRGRSCMVGSTPGVTKSMQEVELDSKIKLIDCP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 59/240 (25%)
YqeH 145..332 CDD:206748 54/224 (24%)
Ns1NP_732199.2 GN3L_Grn1 17..88 CDD:285863 2/4 (50%)
SurA_N_3 59..>150 CDD:304439 13/66 (20%)
RbgA 121..443 CDD:224083 50/202 (25%)
Nucleostemin_like 152..322 CDD:206753 46/171 (27%)
Ras_like_GTPase 271..>400 CDD:206648 16/50 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435335
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.