DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and Gnl1

DIOPT Version :9

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_997665.1 Gene:Gnl1 / 309593 RGDID:1303051 Length:607 Species:Rattus norvegicus


Alignment Length:250 Identity:52/250 - (20%)
Similarity:79/250 - (31%) Gaps:99/250 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 RIQDKFALAIVLVDL----LDFPCSIWPGMQNILGAKRPVFLVGNKVDLLPRD-----SNIYLQH 228
            |:.:...:.:::.|:    ::||.:::..:...||.  .:.||.|||||.|..     .:.:.||
  Rat   183 RVLEMSDIVLLITDIRHPVVNFPPALYEYVTGELGL--ALVLVLNKVDLAPPALVVAWKHYFHQH 245

  Fly   229 -------------------------IKDSLQR-----------------EFIKHGGGN------- 244
                                     :|.|.:|                 |.|..|..:       
  Rat   246 YPQLHIVLFTSFPRDTRTPQEPGSVLKKSRRRGRGWTRALGPEQLLRACEAITVGKVDLSSWREK 310

  Fly   245 ------GLNIKNVS------------LISAKTGYGIEELITQLHKTWAYKGDVYLVGCT---NVG 288
                  |.:..|||            |:..:|...:|.......:   ||..|..:||.   |||
  Rat   311 IARDVAGASWGNVSGEEEEEEDGPAVLVEQQTDSAMEPTGPSRER---YKDGVVTIGCVGFPNVG 372

  Fly   289 KSSLFNILLNSDYCRPEASD----------LVRKATTCPWPGTTLKLLRFPILRP 333
            ||||.|.|:.........:.          |......|..||     |.||.|.|
  Rat   373 KSSLINGLVGRKVVSVSRTPGHTRYFQTYFLTPSVKLCDCPG-----LIFPSLLP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 51/249 (20%)
YqeH 145..332 CDD:206748 50/247 (20%)
Gnl1NP_997665.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81
HSR1_MMR1 177..418 CDD:206750 48/244 (20%)
rbgA 179..516 CDD:236570 51/249 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 544..607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.