DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and GNL2

DIOPT Version :9

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_001310552.1 Gene:GNL2 / 29889 HGNCID:29925 Length:799 Species:Homo sapiens


Alignment Length:378 Identity:85/378 - (22%)
Similarity:133/378 - (35%) Gaps:107/378 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 VYLVGCTNVGKSSLFNILLNSDYCR--PEASDLVRKATTCPWPGTTLKLLRFPILRPSNDRVYQR 341
            |..:|..||||||:.|.|.:...|.  |.|.:      |..|...||....|.|..|.  .||. 
Human   381 VGFIGYPNVGKSSVINTLRSKKVCNVAPIAGE------TKVWQYITLMRRIFLIDCPG--VVYP- 436

  Fly   342 FKRLVSERSEK-------AEMEKERRAVARETGSAAAAQPVAP--VGRTF--DRRENLHD----- 390
                 ||.||.       .::||.:   :.|....|..:...|  :.:|:  |..||..|     
Human   437 -----SEDSETDIVLKGVVQVEKIK---SPEDHIGAVLERAKPEYISKTYKIDSWENAEDFLEKL 493

  Fly   391 AF----AMAGGSRPITT-----LND--RGKEYKEARWVYDTPGVMQPDQISPLLTAEELVKLQPA 444
            ||    .:.||...:.|     |||  ||:          .|..::|....||:..:    |.|:
Human   494 AFRTGKLLKGGEPDLQTVGKMVLNDWQRGR----------IPFFVKPPNAEPLVAPQ----LLPS 544

  Fly   445 TMIR--PRAFRLRP--QMSILLGGLARLDLLEITSPRKHFDWLKVFVFASEHLPIMIADTQEAES 505
            :.:.  |.|.:..|  :::...|..:...:.|.|....|.|       |:..:..::  |:..::
Human   545 SSLEVVPEAAQNNPGEEVTETAGEGSESIIKEETEENSHCD-------ANTEMQQIL--TRVRQN 600

  Fly   506 VYKRYVGSPFLG---VPFASENLEARLRRWPGLQCKDGDIVLASEGRNEETRLNCDITLSSAGWM 567
            ..|..|...|.|   ||....:||..|..:            :.|...|:.:...|...||:   
Human   601 FGKINVVPQFSGDDLVPVEVSDLEEELESF------------SDEEEEEQEQQRDDAEESSS--- 650

  Fly   568 GILLPGHSECRLRAWTPKAAGIYRREPALIPLADRLVGKHIRYSLAYNTAKPF 620
                           .|:...:.....|:|...|..:.|:.:: |....||.|
Human   651 ---------------EPEEENVGNDTKAVIKALDEKIAKYQKF-LDKAKAKKF 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 77/352 (22%)
YqeH 145..332 CDD:206748 19/54 (35%)
GNL2NP_001310552.1 NGP1NT 44..174 CDD:285379
RbgA 190..534 CDD:224083 48/179 (27%)
NGP_1 209..433 CDD:206751 20/59 (34%)
AtpF 661..>756 CDD:223783 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.