DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and Gnl3

DIOPT Version :9

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_783170.1 Gene:Gnl3 / 290556 RGDID:631354 Length:538 Species:Rattus norvegicus


Alignment Length:284 Identity:62/284 - (21%)
Similarity:89/284 - (31%) Gaps:104/284 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ERYKDHEHVHYSSVLETKIKPSFSIPETQQHLPDDWMDDYEFYQGAQEGGNKQGTPDPSLPASKV 107
            |..|..:.:......|.|.|...|        |||...:.|..:.:.|...|:.......|..  
  Rat    72 EELKQQQKLDRQKEQERKRKLEIS--------PDDEQSNVETQEESDEPKIKKAKSGKQNPKK-- 126

  Fly   108 PCNGCGADLHCTNASLPGYIPSEIFRDRTQQELQTITCKRCHFLNHYNIALDVVVAPSTYVDTIS 172
                    |||                   |||:.:       :...:|.|:|:.|.        
  Rat   127 --------LHC-------------------QELKKV-------IEASDIVLEVLDAR-------- 149

  Fly   173 RIQDKFALAIVLVDLLDFPCSIWPGMQNIL---GAKRPVFLVGNKVDLLPRDS-NIYLQHIKDSL 233
                         |.|...|   |.::..:   |.|:.| ||.||.||:|::: ..:|.::...|
  Rat   150 -------------DPLGCRC---PQVEEAVIQSGCKKLV-LVLNKSDLVPKENLENWLTYLNKEL 197

  Fly   234 QREFIKHGGGNGLNIKN----------VSLISAKTGYGIEELITQLHKTWAYKG----------D 278
            .....|    ...|:||          |....:|...|.|.|       |...|          .
  Rat   198 PTVVFK----ASTNLKNRKKTFKIKKKVVPFQSKLCCGKEAL-------WKLLGGFQQSCGKGVQ 251

  Fly   279 VYLVGCTNVGKSSLFNILLNSDYC 302
            |.:||..||||||:.|.|.....|
  Rat   252 VGVVGFPNVGKSSIINSLKQERIC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 49/218 (22%)
YqeH 145..332 CDD:206748 43/182 (24%)
Gnl3NP_783170.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..125 12/60 (20%)
Basic 2..46
GN3L_Grn1 16..93 CDD:285863 5/20 (25%)
RbgA 125..420 CDD:224083 49/223 (22%)
Nucleostemin_like 140..302 CDD:206753 43/172 (25%)
Intermediate 277..451
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 460..538
Acidic 460..532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334367
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.