powered by:
Protein Alignment CG10914 and Lsg1
DIOPT Version :9
Sequence 1: | NP_611297.3 |
Gene: | CG10914 / 37075 |
FlyBaseID: | FBgn0034307 |
Length: | 624 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001013439.1 |
Gene: | Lsg1 / 288029 |
RGDID: | 1309089 |
Length: | 655 |
Species: | Rattus norvegicus |
Alignment Length: | 62 |
Identity: | 20/62 - (32%) |
Similarity: | 26/62 - (41%) |
Gaps: | 14/62 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 264 ELITQLHKTWAYKG---DVYLVGCTNVGKSSLFNILLNSDYCRPEASDLVRKATTCPWPGTT 322
||..:||.....|. .|.|||..||||||..|.::.: :|.:....||.|
Rat 368 ELFKKLHTGKKVKDGQLTVGLVGYPNVGKSSTINTIMGN-----------KKVSVSATPGHT 418
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1161 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.