DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and GNL3

DIOPT Version :9

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_055181.3 Gene:GNL3 / 26354 HGNCID:29931 Length:549 Species:Homo sapiens


Alignment Length:229 Identity:52/229 - (22%)
Similarity:90/229 - (39%) Gaps:28/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 YVDTISRIQDKFALAIVLVDLLD-FPCSIWPGMQNIL---GAKRPVFLVGNKVDLLPRDS-NIYL 226
            |...:.::.:...:.:.::|..| ..|.. |.::..:   |.|:.| |:.||.||:|::: ..:|
Human   130 YCQELKKVIEASDVVLEVLDARDPLGCRC-PQVEEAIVQSGQKKLV-LILNKSDLVPKENLESWL 192

  Fly   227 QHIKDSLQREFI------KHGGGNGLNI---KNVSLISAKTGYGIE---ELITQLHKTWAYKGDV 279
            .::|..|.....      |..|.....:   ||.:...::..:|.|   :|:....:|.:....|
Human   193 NYLKKELPTVVFRASTKPKDKGKITKRVKAKKNAAPFRSEVCFGKEGLWKLLGGFQETCSKAIRV 257

  Fly   280 YLVGCTNVGKSSLFNILLNSDYCRPEAS-DLVRKATTCPWPGTTLKLLRFP--ILRPSNDRVYQR 341
            .::|..||||||:.|.|.....|....| .|.|.....|. ...:.::..|  |:.|.|..    
Human   258 GVIGFPNVGKSSIINSLKQEQMCNVGVSMGLTRSMQVVPL-DKQITIIDSPSFIVSPLNSS---- 317

  Fly   342 FKRLVSERSEKAEMEKERRAVARETGSAAAAQPV 375
             ..|........|:.|...|.:.....|.|.|.|
Human   318 -SALALRSPASIEVVKPMEAASAILSQADARQVV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 52/229 (23%)
YqeH 145..332 CDD:206748 42/184 (23%)
GNL3NP_055181.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Basic. /evidence=ECO:0000250 2..46
GN3L_Grn1 16..85 CDD:285863
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..104
RbgA 133..419 CDD:224083 51/226 (23%)
Nucleostemin_like 142..307 CDD:206753 39/167 (23%)
Intermediate. /evidence=ECO:0000250 282..456 16/75 (21%)
Acidic. /evidence=ECO:0000250 465..543
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 474..532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140678
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.