DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and Mtg1

DIOPT Version :9

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_955005.2 Gene:Mtg1 / 212508 MGIID:2685015 Length:326 Species:Mus musculus


Alignment Length:111 Identity:30/111 - (27%)
Similarity:46/111 - (41%) Gaps:24/111 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 PGMQNILGAKRPVFLVGNKVDLLPRDSNIYLQHIKDSLQREFIKHGGGNGLNIKNVSLISAKTGY 260
            |..|.:||.| |..||.||:||......   |.|...|:.:          .:.||...:.....
Mouse    66 PLFQELLGLK-PHLLVLNKMDLADLTEQ---QKIVQRLEEK----------GLSNVLFTNCVKDE 116

  Fly   261 GIEELITQL----------HKTWAYKGDVYLVGCTNVGKSSLFNIL 296
            .|::::.::          |:....:..:.:||..|||||||.|.|
Mouse   117 NIKQIVPKVMELIRCSYRYHRAETPEYCIMVVGVPNVGKSSLINSL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 30/111 (27%)
YqeH 145..332 CDD:206748 30/111 (27%)
Mtg1NP_955005.2 GTPase_YlqF 29..319 CDD:274669 30/111 (27%)
YlqF 29..206 CDD:206749 30/111 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.