DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and nst-1

DIOPT Version :9

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:NP_495749.1 Gene:nst-1 / 174329 WormBaseID:WBGene00003821 Length:556 Species:Caenorhabditis elegans


Alignment Length:248 Identity:54/248 - (21%)
Similarity:95/248 - (38%) Gaps:69/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 SRIQDKFALAIVLVDLLDFPCSIWPGMQNI-----LGAKRPVFLVGNKVDLLPRDSNI--YLQHI 229
            |.::....:|.|::.:||....:....:::     .|.||.|.|: ||:||:||: |:  :|:::
 Worm   139 SEVRKTVEIADVIIQVLDARDPLGSRSKSVEDQVLKGGKRLVLLL-NKIDLVPRE-NVQKWLEYL 201

  Fly   230 ---------KDSLQREFIKHGGGNGLNIKNVSLISAKTGYGIEELITQLHKTWAYKGD------V 279
                     |.|.|.:....|..|...:.|.. .|...|   .:::.::...:....|      |
 Worm   202 RGQFPTIAFKASTQEQKSNIGRFNSAILNNTE-TSKCVG---ADIVMKILANYCRNKDIKTSIRV 262

  Fly   280 YLVGCTNVGKSSLFNILLNSDYCRPEASDLVRKATTCPWPGTTLKLLRFPILRPSNDRVYQRFKR 344
            .:||..||||||:.|.|.....|  ...:|         ||.|.::                   
 Worm   263 GVVGFPNVGKSSVINSLKRRKAC--NVGNL---------PGITKEI------------------- 297

  Fly   345 LVSERSEKAEMEKERRAVARETGSAAAAQ----PVAPVGRTFDRRENLHDAFA 393
                  ::.|::|..|.: ...|....:|    |:....:...|.:||.|..|
 Worm   298 ------QEVELDKNIRLI-DSPGVILVSQKDLDPIEVALKNAIRVDNLLDPIA 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 54/248 (22%)
YqeH 145..332 CDD:206748 43/181 (24%)
nst-1NP_495749.1 GN3L_Grn1 17..84 CDD:285863
RbgA 140..439 CDD:224083 53/247 (21%)
Nucleostemin_like 149..314 CDD:206753 44/207 (21%)
P-loop_NTPase 263..401 CDD:304359 26/118 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.