DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and LOC101883563

DIOPT Version :9

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:XP_005174712.1 Gene:LOC101883563 / 101883563 -ID:- Length:398 Species:Danio rerio


Alignment Length:229 Identity:101/229 - (44%)
Similarity:142/229 - (62%) Gaps:3/229 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GTPDPSLPASKVPCNGCGADLHCTNASLPGYIPSEIFRDRTQ-QELQTITCKRCHFLNHYNIALD 159
            |:||.....|:..|:||||.||||:...|||:|||.::...: ..|:...|:||..:.|...||.
Zfish   163 GSPDAQAALSETSCSGCGALLHCTDPQEPGYLPSEKYKPLLEGGGLERAVCQRCFLIQHQQRALS 227

  Fly   160 VVVAPSTYVDTISRIQDKFALAIVLVDLLDFPCSIWPGMQNILGAKRPVFLVGNKVDLLPRDSNI 224
            |.::|..|...:..|:...||.::::||||.|.||.|.:..:||..:.|.::||||||||.|:..
Zfish   228 VRMSPDQYRAVVGSIRPLSALVLLILDLLDLPHSIIPDLPQLLGRNKRVVVLGNKVDLLPGDAQN 292

  Fly   225 YLQHIKDSLQREFIKHGGGNGLNIKNVSLISAKTGYGIEELITQLHKTWAYKGDVYLVGCTNVGK 289
            |||.::..|..:..:  .|...:.::|.|||||||||||.||:.|.....::|||||:|..|.||
Zfish   293 YLQRVRRQLMADCAR--AGISADPRDVHLISAKTGYGIETLISSLQTRGRHRGDVYLIGMANAGK 355

  Fly   290 SSLFNILLNSDYCRPEASDLVRKATTCPWPGTTL 323
            |:|||.||.||||:..|:|.:.:||..||||.||
Zfish   356 STLFNTLLESDYCKSTAADAIHRATISPWPGQTL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 97/216 (45%)
YqeH 145..332 CDD:206748 81/179 (45%)
LOC101883563XP_005174712.1 YqeH 213..390 CDD:206748 81/179 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H10518
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.