DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10914 and mtg1

DIOPT Version :9

Sequence 1:NP_611297.3 Gene:CG10914 / 37075 FlyBaseID:FBgn0034307 Length:624 Species:Drosophila melanogaster
Sequence 2:XP_021336162.1 Gene:mtg1 / 100150980 ZFINID:ZDB-GENE-031110-2 Length:319 Species:Danio rerio


Alignment Length:154 Identity:38/154 - (24%)
Similarity:64/154 - (41%) Gaps:34/154 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 RPVFLVGNKVDLLPRDSNIYLQHIKDSLQREFIKHGGGNGL----------NIKNVSLISAKTGY 260
            ||..||.||:|:.....       |.|:.::|.:.|..|.|          |:|.:..:.:|   
Zfish    73 RPHLLVLNKMDVADISK-------KQSILKQFEREGVKNVLFTDCLRQHDENVKKIVPLVSK--- 127

  Fly   261 GIEELITQLHKTWAYKGDVYLVGCTNVGKSSLFNILLNSDYCRPEASD----------LVRKATT 315
             :.|..::.|:.......:.::|..|||||||.|.|..:...:.:||.          ::.|...
Zfish   128 -LIESTSRFHREEERCYCLMVIGVPNVGKSSLINALRRTYLKKGKASKVGAEPGITKAVLTKIQV 191

  Fly   316 CPWPGTTLKLLRFP-ILRPSNDRV 338
            |..|  .:.||..| :|.|..:.:
Zfish   192 CERP--IIHLLDTPGVLPPRIENI 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10914NP_611297.3 GTPase_YqeH 109..596 CDD:213834 38/154 (25%)
YqeH 145..332 CDD:206748 36/146 (25%)
mtg1XP_021336162.1 RbgA 26..319 CDD:331156 38/154 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.