DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5742 and AT1G62045

DIOPT Version :10

Sequence 1:NP_001261069.1 Gene:CG5742 / 37072 FlyBaseID:FBgn0034304 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_564789.1 Gene:AT1G62045 / 842500 AraportID:AT1G62045 Length:67 Species:Arabidopsis thaliana


Alignment Length:42 Identity:9/42 - (21%)
Similarity:16/42 - (38%) Gaps:11/42 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SDEYQSAGEGE-----------DGDGDGDGDSPAERPPDKTS 58
            :|::.:.|.||           |..|...|.:.:.:..|..|
plant     9 ADQWGTGGIGEMPEEDNTKSKKDAGGKNSGQTKSAKIVDFVS 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5742NP_001261069.1 ANKYR <86..>175 CDD:440430
ANK repeat 86..116 CDD:293786
ANK repeat 118..149 CDD:293786
GPCR_chapero_1 234..534 CDD:463391
AT1G62045NP_564789.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.