DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMRE and Smdt1

DIOPT Version :9

Sequence 1:NP_611294.1 Gene:EMRE / 37071 FlyBaseID:FBgn0062440 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_081190.1 Gene:Smdt1 / 69029 MGIID:1916279 Length:107 Species:Mus musculus


Alignment Length:89 Identity:43/89 - (48%)
Similarity:52/89 - (58%) Gaps:15/89 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LPISLALQRVSRRVAEHPHNLRILQRHMSSVYFRSGAIKPKPEEMPFGLLAIFCAVIPGLFVGAT 72
            :|.|..|.:|..|               |.:..|||||.|||.:|.||||.:|..|||.|:||..
Mouse    34 VPGSSGLSQVPSR---------------SVIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTL 83

  Fly    73 ISKNVANFLEENDLFVPADDDDDE 96
            ||||.|..|||:|:|||.|||||:
Mouse    84 ISKNFAALLEEHDIFVPEDDDDDD 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMRENP_611294.1 DDDD 22..90 CDD:401969 32/67 (48%)
Smdt1NP_081190.1 DDDD 33..101 CDD:401969 37/81 (46%)
GXXXX[G/A/S]. /evidence=ECO:0000250|UniProtKB:Q9H4I9 81..85 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837923
Domainoid 1 1.000 78 1.000 Domainoid score I8769
eggNOG 1 0.900 - - E1_KOG4542
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5226
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005704
OrthoInspector 1 1.000 - - oto92961
orthoMCL 1 0.900 - - OOG6_107371
Panther 1 1.100 - - LDO PTHR33904
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4803
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.