DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMRE and smdt1

DIOPT Version :9

Sequence 1:NP_611294.1 Gene:EMRE / 37071 FlyBaseID:FBgn0062440 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001107674.1 Gene:smdt1 / 496604 XenbaseID:XB-GENE-1002274 Length:99 Species:Xenopus tropicalis


Alignment Length:55 Identity:32/55 - (58%)
Similarity:42/55 - (76%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SGAIKPKPEEMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDDE 96
            :|.:.||||::.||||.:|..|||.|::|..||||.|..|||:|:|||.|||||:
 Frog    45 AGTVLPKPEKVSFGLLRVFTVVIPFLYIGTLISKNFAALLEEHDIFVPEDDDDDD 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMRENP_611294.1 DDDD 22..90 CDD:401969 26/47 (55%)
smdt1NP_001107674.1 DDDD 24..93 CDD:370842 26/47 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9065
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5120
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1586309at2759
OrthoFinder 1 1.000 - - FOG0005704
OrthoInspector 1 1.000 - - otm48155
Panther 1 1.100 - - LDO PTHR33904
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4803
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.