DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMRE and CG43321

DIOPT Version :9

Sequence 1:NP_611294.1 Gene:EMRE / 37071 FlyBaseID:FBgn0062440 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001245925.1 Gene:CG43321 / 12798298 FlyBaseID:FBgn0263026 Length:65 Species:Drosophila melanogaster


Alignment Length:50 Identity:19/50 - (38%)
Similarity:29/50 - (57%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KPKPEEMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDD 95
            |.:.|...:..:|:|..||||:.:|..:.|.:|.|||..||:.|...:||
  Fly    16 KIRKENNKYKYIAVFITVIPGIILGGFMGKKLAQFLEVFDLYAPDVSEDD 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMRENP_611294.1 DDDD 22..90 CDD:401969 16/43 (37%)
CG43321NP_001245925.1 DDDD <27..59 CDD:287170 14/31 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR33904
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.