powered by:
Protein Alignment EMRE and CG43321
DIOPT Version :9
Sequence 1: | NP_611294.1 |
Gene: | EMRE / 37071 |
FlyBaseID: | FBgn0062440 |
Length: | 97 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001245925.1 |
Gene: | CG43321 / 12798298 |
FlyBaseID: | FBgn0263026 |
Length: | 65 |
Species: | Drosophila melanogaster |
Alignment Length: | 50 |
Identity: | 19/50 - (38%) |
Similarity: | 29/50 - (57%) |
Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 KPKPEEMPFGLLAIFCAVIPGLFVGATISKNVANFLEENDLFVPADDDDD 95
|.:.|...:..:|:|..||||:.:|..:.|.:|.|||..||:.|...:||
Fly 16 KIRKENNKYKYIAVFITVIPGIILGGFMGKKLAQFLEVFDLYAPDVSEDD 65
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
EMRE | NP_611294.1 |
DDDD |
22..90 |
CDD:401969 |
16/43 (37%) |
CG43321 | NP_001245925.1 |
DDDD |
<27..59 |
CDD:287170 |
14/31 (45%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR33904 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.