DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pAbp and PES4

DIOPT Version :9

Sequence 1:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_116678.1 Gene:PES4 / 850579 SGDID:S000001919 Length:611 Species:Saccharomyces cerevisiae


Alignment Length:490 Identity:140/490 - (28%)
Similarity:216/490 - (44%) Gaps:80/490 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASLYVGDLPQDVNE---SGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDT 62
            :..|::|||.:.|.|   .|:|.|:.|   .:|.:||.|.:|::|||:.|:||:...:||:|::.
Yeast    90 LVPLFIGDLHETVTEETLKGIFKKYPS---FVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEE 151

  Fly    63 MNFDLVRNKPIRIMWSQRDPSLRRSGVGNVFIKNL---DRAIDNKAIYDTFSAFGNILSCKVATD 124
            :|:..|..|.||||.|.|:.:.|::...|||..||   :..:..:..|||||.:|.|||||:   
Yeast   152 LNYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRYGKILSCKL--- 213

  Fly   125 EKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVG-----------KFIPRK--------- 169
              .:.|..|||:||.|:.|...|...|.....|||:..|           .|..:|         
Yeast   214 --DSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGIHFDKEVRSVPNFETQKSRLDAETII 276

  Fly   170 EREKELGEK-----AKLFTNVY--------VKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGK 221
            |:|:.|.||     .|...|:|        :||.......:.:..||...|.|.|..:.:....|
Yeast   277 EKEQSLNEKHSKGNDKESKNIYSSSQNSIFIKNLPTITTRDDILNFFSEVGPIKSIYLSNATKVK 341

  Fly   222 SKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKRHESVFG 286
            .. :.||.::.:..:|.|::..|.... .||.|.|.|||.|.||     .||.| .||..     
Yeast   342 YL-WAFVTYKNSSDSEKAIKRYNNFYF-RGKKLLVTRAQDKEER-----AKFIE-SQKIS----- 393

  Fly   287 VNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTD--EEGRSKGFGFVCFNAASEATCAVTELNG 349
             .|:::||....:.:.|:. .....||...|:..|  :|..|...||:.|....:||.....||.
Yeast   394 -TLFLENLSAVCNKEFLKY-LCHQENIRPFKIQIDGYDENSSTYSGFIKFRNFEDATRIFNFLNN 456

  Fly   350 RVVGSKPLYVALAQRKEERKAHLASQY-MRHMTGMRMQQLGQIYQPNAASGFFVP---------- 403
            |:||...:..:..::....|.|  ..| ||::......|:...||.:.|:....|          
Yeast   457 RLVGGSIVTTSWERQNNAPKYH--DGYGMRNIHTSSHPQITPYYQYSHANSLNSPHMRDLSSMNS 519

  Fly   404 ---TLPSNQRFFGSQVATQMRNTPRWVPQVRPPAA 435
               :|..|:.|....:.|..:...|.:..:|.|:|
Yeast   520 STRSLIKNKNFNKKVLETFEKQVRRGIDFMRFPSA 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 140/489 (29%)
PES4NP_116678.1 PABP-1234 93..>461 CDD:130689 121/390 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S574
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.