DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pAbp and PAB1

DIOPT Version :9

Sequence 1:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_174676.2 Gene:PAB1 / 840313 AraportID:AT1G34140 Length:407 Species:Arabidopsis thaliana


Alignment Length:399 Identity:168/399 - (42%)
Similarity:244/399 - (61%) Gaps:31/399 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LDTMNFDLVRNKPIRIMWSQRDPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATD 124
            ::.:|:..::.||:|||:|:||||.|.||.||||:||||.:||||.:.|.|||||.:||||||.|
plant     1 MEVLNYCKLKGKPMRIMFSERDPSNRMSGRGNVFVKNLDESIDNKQLCDMFSAFGKVLSCKVARD 65

  Fly   125 EKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKN 189
            ..|.|||||||.|.::.:..|:.:..||.|:..:.::|..|:.|.:     .:|:::||||||||
plant    66 ASGVSKGYGFVQFYSDLSVYTACNFHNGTLIRNQHIHVCPFVSRGQ-----WDKSRVFTNVYVKN 125

  Fly   190 FTEDFDDEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSL 254
            ..|...|..||..|..:|:|||..||...:|||:.||||.||..|||..|::.:||..:.| |.|
plant   126 LVETATDADLKRLFGEFGEITSAVVMKDGEGKSRRFGFVNFEKAEAAVTAIEKMNGVVVDE-KEL 189

  Fly   255 YVARAQKKAERQQELKRKFE------ELKQKRHESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNI 313
            :|.|||:|..|.::||.|||      ::|.::     |:|||||||||::|:.:|...||.:|.|
plant   190 HVGRAQRKTNRTEDLKAKFELEKIIRDMKTRK-----GMNLYVKNLDDSVDNTKLEELFSEFGTI 249

  Fly   314 TSAKVMTDEEGRSKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQRKEERKAHLASQYMR 378
            ||.|||....|.|||.|||.|:.:.||:.|:.::||::||:||:||:|||.||:.|.||.:|:..
plant   250 TSCKVMVHSNGISKGVGFVEFSTSEEASKAMLKMNGKMVGNKPIYVSLAQCKEQHKLHLQTQFNN 314

  Fly   379 HMTGMRMQQL-GQIYQPNAASGFFVPTLPSNQRFFGSQVATQMRNT------PRWV------PQV 430
            .......|.: .|:..|........|....|.:.: |...::|.|:      |.::      |.:
plant   315 PPPSPHQQPIFSQVVAPATMLSQQTPLRGYNFQPY-SMCGSRMPNSCPPISIPNFMVPQPFRPTL 378

  Fly   431 RPPAAIQGV 439
            .|||.:.|:
plant   379 YPPAPLVGL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 168/399 (42%)
PAB1NP_174676.2 RRM_SF <1..23 CDD:302621 8/21 (38%)
RRM2_I_PABPs 29..105 CDD:240825 40/75 (53%)
ELAV_HUD_SF 30..296 CDD:273741 130/276 (47%)
RRM3_I_PABPs 118..197 CDD:240826 41/79 (52%)
RRM4_I_PABPs 222..299 CDD:240827 41/76 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2686
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53624
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.990

Return to query results.
Submit another query.