DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pAbp and ncl

DIOPT Version :9

Sequence 1:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001070120.2 Gene:ncl / 767714 ZFINID:ZDB-GENE-030131-6986 Length:705 Species:Danio rerio


Alignment Length:368 Identity:96/368 - (26%)
Similarity:172/368 - (46%) Gaps:49/368 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLYVGDL--PQDVNE--SGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTM 63
            ||::|:|  .:|.:|  |.:...||..|  |.|   :||....:..:.||:|....:.::||: :
Zfish   288 SLFLGNLNNNKDFDELKSAISKFFSKEG--LEI---QDVRLGGTKKFGYVDFASEEELQKALE-L 346

  Fly    64 NFDLVRNKPIRI----MWSQRDPSLRRSGVGNVFIKNLDRAI---DNKAIYDTFSAFGNILSCKV 121
            |...:..:|:::    .......:.:......:|:|||..:|   |.:.|:|      ..:..:|
Zfish   347 NGKKLLGQPVKLDKARSKENSQENKKERDARTLFVKNLPYSITQDDLREIFD------QAVDIRV 405

  Fly   122 ATDEKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELG--EKAKLFTN 184
            .....|.|:|..::.|:||..|..::::..|..:.|:.:.| .|...|.|:...|  ..:|:   
Zfish   406 PMGNTGTSRGIAYIEFKTEAIAEKALEEAQGSDVQGRSIIV-DFTGDKSRQGGRGAPSASKV--- 466

  Fly   185 VYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMG 249
            :.|.|......::.|:..||   |..|.:: .:.:|:.||:.||.||..|.::.|::..|..|: 
Zfish   467 LVVNNLAFSASEDSLQSVFE---KAVSIRI-PQNNGRPKGYAFVEFENVEDSKEALENCNNTDI- 526

  Fly   250 EGKSLYVARAQKKAERQQELKRKFEELKQKRHESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNIT 314
            ||:|:.:..:|...||....:......|          .|:||.|.|...|..|:.:|.  |.| 
Zfish   527 EGRSIRLEYSQNDRERGGGGRGNSGPTK----------TLFVKGLSDDTTDQTLKDSFD--GAI- 578

  Fly   315 SAKVMTDEE-GRSKGFGFVCFNAASEATCAVTEL-NGRVVGSK 355
            :|::.||.: |.|||||||.|:...:...|...: :|.:.|:|
Zfish   579 AARIATDRDTGSSKGFGFVDFDNEQDCKAAKEAMDDGEIDGNK 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 96/368 (26%)
nclNP_001070120.2 RRM1_NCL 287..361 CDD:240849 21/78 (27%)
RRM 347..630 CDD:223796 77/303 (25%)
RRM2_NCL 374..450 CDD:240850 20/82 (24%)
RRM3_NCL 464..535 CDD:240851 22/78 (28%)
RRM4_NCL 554..631 CDD:240852 27/81 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.