DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pAbp and Pabpc5

DIOPT Version :9

Sequence 1:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001103836.1 Gene:Pabpc5 / 688518 RGDID:1587661 Length:382 Species:Rattus norvegicus


Alignment Length:365 Identity:208/365 - (56%)
Similarity:266/365 - (72%) Gaps:4/365 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNFD 66
            |:||||||..||.|..|:.||..|||:...|:|||.:||..|||.||||:.|||||.||:|||||
  Rat    18 AALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWALNTMNFD 82

  Fly    67 LVRNKPIRIMWSQRDPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDEKGNSKG 131
            |:..||.|:||||.|..||:|||||:||||||::|||:|::..||||||||||||..|:.| |||
  Rat    83 LINGKPFRLMWSQPDDHLRKSGVGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVVCDDNG-SKG 146

  Fly   132 YGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAK-LFTNVYVKNFTEDFD 195
            |.:|||::..|||.:|..:||:.||.::||||:|...:||..|:..:.: .||||:||||.:|.|
  Rat   147 YAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTNVFVKNFGDDID 211

  Fly   196 DEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQ 260
            |||||:.|..||...|.||:....|||||||||.:||.|||:.||..|:||.: :||.|.|.|||
  Rat   212 DEKLKKLFSEYGPTESVKVIRDATGKSKGFGFVRYETHEAAQKAVLELHGKSI-DGKVLCVGRAQ 275

  Fly   261 KKAERQQELKRKFEELKQKRHESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEEGR 325
            ||.||..||:|:||.||.|......||.:|:||||:||:|::|:..||.:|:|:.||||. |.|:
  Rat   276 KKIERLAELRRRFERLKLKDKTRPPGVPIYIKNLDETINDEKLKEEFSLFGSISRAKVMM-EVGQ 339

  Fly   326 SKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQRK 365
            .||||.|||::..||:.||.|:||||||||.|:|.|.|.:
  Rat   340 GKGFGVVCFSSFEEASKAVNEMNGRVVGSKTLHVTLGQAR 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 208/365 (57%)
Pabpc5NP_001103836.1 RRM1_I_PABPs 22..98 CDD:240824 46/75 (61%)
ELAV_HUD_SF 29..271 CDD:273741 139/243 (57%)
RRM2_I_PABPs 104..179 CDD:240825 46/75 (61%)
RRM3_I_PABPs 198..277 CDD:240826 47/79 (59%)
RRM_SF 301..377 CDD:302621 44/76 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8281
eggNOG 1 0.900 - - E1_KOG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.