DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pAbp and PABPC1L2B

DIOPT Version :9

Sequence 1:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001035971.1 Gene:PABPC1L2B / 645974 HGNCID:31852 Length:200 Species:Homo sapiens


Alignment Length:197 Identity:132/197 - (67%)
Similarity:164/197 - (83%) Gaps:1/197 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNF 65
            |||||||||..:|.|:.|::|||.|||:||||:|||.||||||||||||:|||.||:|||:|:||
Human     1 MASLYVGDLHPEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRALETLNF 65

  Fly    66 DLVRNKPIRIMWSQRDPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDEKGNSK 130
            |:::.:|:||||||||||||:|||||||||||.:.|||||:|:.|||||||||||||.|||| .|
Human    66 DVIKGRPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIFSAFGNILSCKVACDEKG-PK 129

  Fly   131 GYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFD 195
            |||||||:.:|:|..:||.:|||.||.:|::||:|...||||.|.|..|:..|:..||:|.||.|
Human   130 GYGFVHFQKQESAERAIDVMNGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTD 194

  Fly   196 DE 197
            :|
Human   195 EE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 131/196 (67%)
PABPC1L2BNP_001035971.1 PABP-1234 2..>196 CDD:130689 130/194 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..200 13/27 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5639
eggNOG 1 0.900 - - E1_KOG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.