DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pAbp and CG5213

DIOPT Version :9

Sequence 1:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:233 Identity:58/233 - (24%)
Similarity:104/233 - (44%) Gaps:35/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 VNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKV 214
            :.||...|:.|.....:|          ..::.||:.:....:|..:.:|...|..:|:|...|:
  Fly    18 IRGMFQTGRPVDPPPPLP----------NLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKI 72

  Fly   215 M-SKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQ 278
            : .:..|.|..:|||.:.:...|.|||..::|.:. .||.|.||.|                 :.
  Fly    73 IRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYET-RGKRLKVAFA-----------------RP 119

  Fly   279 KRHESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDE-EGRSKGFGFVCFNAASEATC 342
            ..:||. ..:|||.||...:|:.::|..|:.||||....::..: ..||:|..|:.|....:|..
  Fly   120 SEYEST-SSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEV 183

  Fly   343 AVTELNGRVV--GSKPLYVALAQRKEERKAHLA--SQY 376
            |...::..::  .|:||.|...:|:::..:..:  |||
  Fly   184 AKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSGSQY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 58/233 (25%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 23/76 (30%)
RRM 128..202 CDD:214636 22/73 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439577
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.