DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pAbp and cocoon

DIOPT Version :9

Sequence 1:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster


Alignment Length:219 Identity:48/219 - (21%)
Similarity:90/219 - (41%) Gaps:52/219 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 FSAFGNILSCKVATDEK-GNSKGYGFVHFETEEAANTSIDKVNGMLLNGK----KVYVGKFIPRK 169
            |..:|:::..::..|.: |:|||:|||.|.:.:.....:.|.:.  ::|:    ||...:.:..:
  Fly   127 FETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSKRHS--IDGRWCEVKVPASRGMGNQ 189

  Fly   170 EREKELGEKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTE 234
            |..|           |:|...|||.:.:.|:|:|..:|::....:..    ..:.|.||.|....
  Fly   190 EPGK-----------VFVGRCTEDIEADDLREYFSKFGEVIDVFIPK----PFRAFSFVTFLDPY 239

  Fly   235 AAEAAVQALNGKDMGEGKSLYVARAQKKAERQQELKRKFEELKQKRHESVFGVNLYVKNLDDTI- 298
            ....   ....|.:.:|.|::|:.|.||              ..:....:|..|.| .|||:.. 
  Fly   240 VPRV---VCGEKHIIKGVSVHVSTADKK--------------NVQNKNQLFQTNNY-NNLDNNFK 286

  Fly   299 ----DDDRLRIA-------FSPYG 311
                ::.|:..|       |:|:|
  Fly   287 MQPANNFRMHPANNFSMHSFNPHG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 48/219 (22%)
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767 15/58 (26%)
RRM2_TDP43 193..262 CDD:240768 18/86 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.