DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pAbp and RBMY1E

DIOPT Version :9

Sequence 1:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001006118.2 Gene:RBMY1E / 378950 HGNCID:23916 Length:496 Species:Homo sapiens


Alignment Length:85 Identity:27/85 - (31%)
Similarity:48/85 - (56%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNFDLV 68
            |::|.|.::.||..|...|...||:..:.:.:| .|.:|.|:|::.|:.||||:.|...||...:
Human    10 LFIGGLNRETNEKMLKAVFGKHGPISEVLLIKD-RTSKSRGFAFITFENPADAKNAAKDMNGKSL 73

  Fly    69 RNKPIRIMWSQRDPSLRRSG 88
            ..|.|::..::: ||.:..|
Human    74 HGKAIKVEQAKK-PSFQSGG 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 27/85 (32%)
RBMY1ENP_001006118.2 RRM <1..189 CDD:223796 27/85 (32%)
RRM_RBMX_like 7..85 CDD:240828 24/75 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..348 7/27 (26%)
RBM1CTR 174..218 CDD:285341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 453..496
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.