DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pAbp and fne

DIOPT Version :9

Sequence 1:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster


Alignment Length:334 Identity:86/334 - (25%)
Similarity:140/334 - (41%) Gaps:67/334 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 NVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATD-------------------EKGNSKGYGFVH 136
            |:.:..|.:.:..:.:...||:.|.:.|||:..|                   ::|.|.|||||:
  Fly    27 NLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSLGYGFVN 91

  Fly   137 FETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFDDEKLKE 201
            :...|.|..:::.:||:.|..|.:.|....|..|..|.        .|:||....::.....|:.
  Fly    92 YVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKG--------ANLYVSGLPKNLSQPDLEG 148

  Fly   202 FFEPYGKITSYKVMSKE-DGKSKGFGFVAFETTEAAEAAVQALNGK-DMGEGKSLYV-------- 256
            .|..:|||.:.:::... .|.|||.||:.|:....||.|:|.|||| ..|..:.:.|        
  Fly   149 MFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSN 213

  Fly   257 -ARAQ-----------KKAERQQELKRKFEELKQKRHESVFG---VN--------------LYVK 292
             |:||           :.|...:.|........:.|:..:.|   .|              ::|.
  Fly   214 SAKAQIAPPLTAYLTPQAAAATRRLAGALPSAGRIRYSPLAGDLLANSILPGNAMTGSGWCIFVY 278

  Fly   293 NLDDTIDDDRLRIAFSPYGNITSAKVMTD-EEGRSKGFGFVCFNAASEATCAVTELNGRVVGSKP 356
            ||....:::.|...|.|:|.:.|.||:.| :..:.||||||......||..|:..|||..:|::.
  Fly   279 NLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSLNGYTLGNRV 343

  Fly   357 LYVALAQRK 365
            |.|:....|
  Fly   344 LQVSFKTNK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 86/334 (26%)
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 86/334 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439613
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.