DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pAbp and Ncl

DIOPT Version :9

Sequence 1:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_035010.3 Gene:Ncl / 17975 MGIID:97286 Length:707 Species:Mus musculus


Alignment Length:365 Identity:97/365 - (26%)
Similarity:172/365 - (47%) Gaps:50/365 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLYVGDL--PQDVNE-----SGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERAL 60
            :|::|:|  .:.|||     |.||.|...|  |:.:|..    |.|..|  ||:|:...|.|:||
Mouse   310 NLFIGNLNPNKSVNELKFAISELFAKNDLA--VVDVRTG----TNRKFG--YVDFESAEDLEKAL 366

  Fly    61 DTMNFDLVRNKPIRIMWSQRDPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDE 125
            :.....:..|: |::...:...|.:......:..|||...|....:.:.|.   :.:..::.:.:
Mouse   367 ELTGLKVFGNE-IKLEKPKGRDSKKVRAARTLLAKNLSFNITEDELKEVFE---DAMEIRLVSQD 427

  Fly   126 KGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKV---YVGKFIPRKEREKELGEKAKLFTNVYV 187
             |.|||..::.|::|..|..::::..|..::|:.|   |.|:...|:||..:....:.....:.:
Mouse   428 -GKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTGKTSTWSGESKTLVL 491

  Fly   188 KNFTEDFDDEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGK 252
            .|.:.....|.|:|.||   |.|..||.....||.||:.|:.|.:.|.|:.|:.:.|..:: ||:
Mouse   492 SNLSYSATKETLEEVFE---KATFIKVPQNPHGKPKGYAFIEFASFEDAKEALNSCNKMEI-EGR 552

  Fly   253 SLYVARAQKKAERQQELKRKFEELKQKRHESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNITSAK 317
            ::.:                  ||:.....|.....|:||.|.:...::.|:.:|.  |:: .|:
Mouse   553 TIRL------------------ELQGSNSRSQPSKTLFVKGLSEDTTEETLKESFE--GSV-RAR 596

  Fly   318 VMTDEE-GRSKGFGFVCFNAASEATCAVTEL-NGRVVGSK 355
            ::||.| |.|||||||.||:..:|..|...: :|.:.|:|
Mouse   597 IVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNK 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 97/365 (27%)
NclNP_035010.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..308
8 X 8 AA tandem repeats of X-T-P-X-K-K-X-X 58..135
RRM1_NCL 309..383 CDD:240849 25/81 (31%)
RRM2_NCL 392..467 CDD:240850 16/78 (21%)
RRM3_NCL 486..558 CDD:240851 22/93 (24%)
RRM4_NCL 569..646 CDD:240852 26/71 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.