DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pAbp and PABPC4L

DIOPT Version :9

Sequence 1:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001108206.3 Gene:PABPC4L / 132430 HGNCID:31955 Length:370 Species:Homo sapiens


Alignment Length:364 Identity:228/364 - (62%)
Similarity:290/364 - (79%) Gaps:3/364 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNF 65
            |||||||||..||.|..||.|||:.|||||||:|||.:||||||||||||.|.|||::|||||||
Human     9 MASLYVGDLHADVTEDLLFRKFSTVGPVLSIRICRDQVTRRSLGYAYVNFLQLADAQKALDTMNF 73

  Fly    66 DLVRNKPIRIMWSQRDPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATDEKGNSK 130
            |:::.|.||:||||||..|||||:|||||||||::||||.:|:.|||||.|||.||.:|::| ||
Human    74 DIIKGKSIRLMWSQRDAYLRRSGIGNVFIKNLDKSIDNKTLYEHFSAFGKILSSKVMSDDQG-SK 137

  Fly   131 GYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAKLFTNVYVKNFTEDFD 195
            ||.||||:.:.||:.:|:::||.||.|.||:||:|..||:||.||..||..|||||:|||..|.|
Human   138 GYAFVHFQNQSAADRAIEEMNGKLLKGCKVFVGRFKNRKDREAELRSKASEFTNVYIKNFGGDMD 202

  Fly   196 DEKLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAFETTEAAEAAVQALNGKDMGEGKSLYVARAQ 260
            ||:||:.|..|||..|.|||:...|||||||||:|::.|||:.||:.:||:|: .|:.::|.|||
Human   203 DERLKDVFSKYGKTLSVKVMTDSSGKSKGFGFVSFDSHEAAKKAVEEMNGRDI-NGQLIFVGRAQ 266

  Fly   261 KKAERQQELKRKFEELKQKRHESVFGVNLYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEEGR 325
            ||.|||.|||:.||:||::|.....||.||:|||||||||::||..||.:|:|:..||| .|||:
Human   267 KKVERQAELKQMFEQLKRERIRGCQGVKLYIKNLDDTIDDEKLRNEFSSFGSISRVKVM-QEEGQ 330

  Fly   326 SKGFGFVCFNAASEATCAVTELNGRVVGSKPLYVALAQR 364
            |||||.:||::..:||.|:||:|||::|||||.:|||||
Human   331 SKGFGLICFSSPEDATKAMTEMNGRILGSKPLSIALAQR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 227/363 (63%)
PABPC4LNP_001108206.3 RRM 10..>369 CDD:330708 225/361 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6415
eggNOG 1 0.900 - - E1_KOG0123
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.