DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pAbp and si:ch73-190f9.4

DIOPT Version :9

Sequence 1:NP_476667.1 Gene:pAbp / 37070 FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster
Sequence 2:XP_005161362.1 Gene:si:ch73-190f9.4 / 100332833 ZFINID:ZDB-GENE-131122-94 Length:287 Species:Danio rerio


Alignment Length:194 Identity:50/194 - (25%)
Similarity:75/194 - (38%) Gaps:52/194 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNF 65
            :.:|.|.:|...|.|..|.:||.:.|.:.:::|||:.|.  |..||:|.|....||.||...:||
Zfish    83 LKTLLVSNLHPMVTEQQLIEKFGALGSISTVQVCRNNII--SPAYAFVTFHHRRDAVRAQKALNF 145

  Fly    66 DLVRNKPIRIMW---------SQRDPSL-----RRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNI 116
            ..:.|||:.|||         |..|.|.     .|...|....:......:.||..|        
Zfish   146 TDLLNKPLIIMWGPDKTIEVLSDNDSSSPRQTEERETAGETEERKTSGETERKAAGD-------- 202

  Fly   117 LSCKVATDEKGNSKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAK 180
                  |:|:..|:     ..|.|.|.:|...|.:                 :|.|:|..:|.:
Zfish   203 ------TEERKTSR-----ETEREAAGDTEERKTS-----------------RETERETADKTE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 50/193 (26%)
si:ch73-190f9.4XP_005161362.1 RRM_SF 86..157 CDD:302621 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.