DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcl and bdg

DIOPT Version :9

Sequence 1:NP_001261067.1 Gene:Pcl / 37069 FlyBaseID:FBgn0003044 Length:1043 Species:Drosophila melanogaster
Sequence 2:NP_611064.2 Gene:bdg / 36747 FlyBaseID:FBgn0034049 Length:1331 Species:Drosophila melanogaster


Alignment Length:204 Identity:52/204 - (25%)
Similarity:71/204 - (34%) Gaps:77/204 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 QSYYLPSGGGQ--TAGQI--NLLAASGT-----------GKQLQPPPLVPV-------TNSTSPP 186
            |:...|:.|.|  |...|  |||..:..           |::|:.|| .||       :...|.|
  Fly   340 QASVAPTVGSQMLTEAHIFDNLLQTNARASSEEPRPRQYGRRLEGPP-TPVRPLILAQSRPQSAP 403

  Fly   187 STVVLDRINICINNHYTETPT-------SLSSSLTTAQQPSPIIPAIQHKAILPLIDSSTADSSS 244
            :.|.:....:      .:|||       |..||..:::.|||:              |..:||||
  Fly   404 TRVQMREPQL------QDTPTHPIMSTCSELSSARSSRMPSPV--------------SLPSDSSS 448

  Fly   245 CSSSSVSSSSYSGTATTSAAVVIVDEPDSTTTTPQTPPTTPEAMSSPGKSSPSPPLLATQSLLK- 308
            ..|||....               .|||...||         .|.|...::|..||...|.||: 
  Fly   449 SGSSSAEHD---------------QEPDPVQTT---------TMCSASSTTPLEPLHQLQLLLRE 489

  Fly   309 --GVNSMKP 315
              |.||..|
  Fly   490 KCGFNSQWP 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PclNP_001261067.1 TUDOR 350..399 CDD:197660
PHD_SF 426..469 CDD:304600
PHD2_MTF2_PHF19_like 514..565 CDD:276978
Mtf2_C 985..1032 CDD:290768
bdgNP_611064.2 SLC5-6-like_sbd 501..976 CDD:271356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.