DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcl and phf-30

DIOPT Version :9

Sequence 1:NP_001261067.1 Gene:Pcl / 37069 FlyBaseID:FBgn0003044 Length:1043 Species:Drosophila melanogaster
Sequence 2:NP_505182.1 Gene:phf-30 / 188776 WormBaseID:WBGene00020716 Length:234 Species:Caenorhabditis elegans


Alignment Length:274 Identity:52/274 - (18%)
Similarity:81/274 - (29%) Gaps:102/274 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 VVIVDEPDSTTTTPQTP--------PTTPEAMSSPGKSSP---SPPLLATQSLLKGVNSMKPSFK 318
            ::::||...|:.:|:..        .|..:.|.|..||:.   |..:..|.||....|:......
 Worm     8 ILMIDEKQDTSESPEEEKFDANAYISTLIKFMKSIDKSTDKEFSELVAKTWSLSSSTNNFYTDSF 72

  Fly   319 TVEAAPPTPPTPPSPPPPPPAPPVAAPSPAVTYALQEDVFIKCNDGRFYLGTIIDQTSDQYLIRF 383
            |:::...:...|.                            ..|..:...||             
 Worm    73 TMDSGNVSKLNPN----------------------------MLNPQKRIAGT------------- 96

  Fly   384 DDQSEQWCEPDKLRKLG------GGSSITAGGGGASTTE----------STNTSPSGPMCVACKR 432
              |...:..|..|.|.|      |.||.:|.||.....:          .|:..|    |..|..
 Worm    97 --QRLMYAPPQILNKSGFVIDKSGASSSSAPGGMKKLKKLVPVIDDSIYCTSEQP----CAVCHG 155

  Fly   433 SDIE-DVVEICERCGRGYHRGCTVEIVT------GSGIWSCKRC--------------------- 469
            ..:. :.|..|.||...||..|::..|:      .|..:.||.|                     
 Worm   156 VSLAGNQVLACRRCRDCYHMACSIPTVSIEEASEPSFKYYCKTCLVSKKVIDSNRSRSPSPAKLD 220

  Fly   470 AKPMKMQQPVSHKI 483
            ||.|||.:..:.|:
 Worm   221 AKRMKMGRDRTTKL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PclNP_001261067.1 TUDOR 350..399 CDD:197660 6/48 (13%)
PHD_SF 426..469 CDD:304600 13/49 (27%)
PHD2_MTF2_PHF19_like 514..565 CDD:276978
Mtf2_C 985..1032 CDD:290768
phf-30NP_505182.1 PHD 150..202 CDD:366208 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4323
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.